Constant Field Values
Contents
com.itextpdf.*
-
com.itextpdf.barcodes.Barcode128Modifier and TypeConstant FieldValue
public static final char
'\u00c8'
public static final char
'c'
public static final char
'd'
public static final char
'e'
public static final char
'\u00c7'
public static final int
1
public static final int
3
public static final int
2
public static final char
'\u00c3'
public static final char
'\u00ca'
public static final char
'f'
public static final char
'\u00c5'
public static final char
'\u00c4'
public static final char
'\u00c8'
public static final char
'\u00c6'
public static final char
'g'
public static final char
'h'
public static final char
'i'
public static final char
'\u00cb'
public static final char
'\u00cc'
public static final char
'\u00cd'
-
com.itextpdf.barcodes.Barcode1DModifier and TypeConstant FieldValue
public static final int
3
public static final int
1
public static final int
2
-
com.itextpdf.barcodes.Barcode2D
-
com.itextpdf.barcodes.Barcode39Modifier and TypeConstant FieldValue
private static final String
"0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ-. $/+%*"
private static final String
"%U$A$B$C$D$E$F$G$H$I$J$K$L$M$N$O$P$Q$R$S$T$U$V$W$X$Y$Z%A%B%C%D%E /A/B/C/D/E/F/G/H/I/J/K/L - ./O 0 1 2 3 4 5 6 7 8 9/Z%F%G%H%I%J%V A B C D E F G H I J K L M N O P Q R S T U V W X Y Z%K%L%M%N%O%W+A+B+C+D+E+F+G+H+I+J+K+L+M+N+O+P+Q+R+S+T+U+V+W+X+Y+Z%P%Q%R%S%T"
-
com.itextpdf.barcodes.BarcodeCodabarModifier and TypeConstant FieldValue
private static final String
"0123456789-$:/.+ABCD"
private static final int
16
-
com.itextpdf.barcodes.BarcodeDataMatrixModifier and TypeConstant FieldValue
public static final String
"iso-8859-1"
public static final int
1
public static final int
0
public static final int
4
public static final int
2
public static final int
6
public static final int
5
public static final int
3
public static final int
1
public static final int
32
public static final int
0
public static final int
7
public static final int
64
public static final int
3
public static final int
5
private static final byte
0xeb
private static final byte
0xe7
private static final byte
0xe6
private static final byte
0xf0
private static final byte
0xef
private static final byte
0xee
private static final byte
0x81
private static final byte
0xfe
private static final String
"\r*> 0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ"
-
com.itextpdf.barcodes.BarcodeEANModifier and TypeConstant FieldValue
public static final int
1
public static final int
2
private static final int
1
private static final int
0
public static final int
5
public static final int
6
private static final int
59
private static final int
43
private static final int
13
private static final int
31
private static final int
33
public static final int
3
public static final int
4
-
com.itextpdf.barcodes.BarcodeMSIModifier and TypeConstant FieldValue
private static final int
3
private static final int
4
private static final int
12
private static final String
"0123456789"
-
com.itextpdf.barcodes.BarcodePDF417Modifier and TypeConstant FieldValue
protected static final int
5420
protected static final int
28
protected static final int
65536
protected static final int
27
protected static final int
901
protected static final int
924
protected static final int
913
protected static final float
1.0f
protected static final float
1.0f
protected static final int
1048576
protected static final int
27
protected static final int
131072
protected static final int
922
protected static final int
928
protected static final int
926
protected static final int
262144
private static final String
"0123456789&\r\t,:#-.$/+%*=^"
protected static final int
28
protected static final int
929
protected static final int
902
protected static final int
29
public static final int
0
public static final int
2
public static final int
1
public static final int
4
public static final int
32
public static final int
128
public static final int
0
public static final int
16
public static final int
256
public static final int
64
protected static final int
25
protected static final int
29
protected static final int
524288
private static final String
";<>@[\\]_`~!\r\t,:\n-.$/\"|*()?{}\'"
protected static final int
26
protected static final int
17
protected static final int
130728
protected static final int
260649
protected static final int
18
protected static final int
900
-
com.itextpdf.barcodes.exceptions.BarcodesExceptionMessageConstantModifier and TypeConstant FieldValue
public static final String
"Codabar must have at least start and stop character."
public static final String
"Codabar must have one of \'ABCD\' as start/stop character."
public static final String
"Illegal character in Codabar Barcode."
public static final String
"In Codabar, start/stop characters are only allowed at the extremes."
public static final String
"Invalid codeword size."
public static final String
"macroSegmentId must be >= 0"
public static final String
"macroSegmentId must be > 0"
public static final String
"macroSegmentId must be < macroSemgentCount"
public static final String
"Text cannot be null."
public static final String
"Text is too big."
public static final String
"The text length must be even."
public static final String
"There are illegal characters for barcode 128 in {0}."
public static final String
"The two barcodes must be composed externally."
-
com.itextpdf.barcodes.qrcode.com.itextpdf.barcodes.qrcode.BitVector
-
com.itextpdf.barcodes.qrcode.com.itextpdf.barcodes.qrcode.ByteArray
-
com.itextpdf.barcodes.qrcode.com.itextpdf.barcodes.qrcode.Encoder
-
com.itextpdf.barcodes.qrcode.com.itextpdf.barcodes.qrcode.FormatInformation
-
com.itextpdf.barcodes.qrcode.com.itextpdf.barcodes.qrcode.MatrixUtilModifier and TypeConstant FieldValue
private static final int
21522
private static final int
1335
private static final int
7973
-
com.itextpdf.barcodes.qrcode.com.itextpdf.barcodes.qrcode.QRCode
-
com.itextpdf.barcodes.qrcode.QRCodeWriter
-
com.itextpdf.bouncycastle.asn1.ocsp.OCSPResponseStatusBC
-
com.itextpdf.bouncycastle.asn1.x509.CRLReasonBCModifier and TypeConstant FieldValue
private static final int
1
private static final int
8
-
com.itextpdf.bouncycastle.asn1.x509.DistributionPointNameBC
-
com.itextpdf.bouncycastle.asn1.x509.GeneralNameBC
-
com.itextpdf.bouncycastle.cert.ocsp.OCSPRespBC
-
com.itextpdf.bouncycastle.cert.ocsp.OCSPRespBuilderBC
-
com.itextpdf.bouncycastleconnector.BouncyCastleFactoryCreatorModifier and TypeConstant FieldValue
private static final String
"ITEXT_BOUNCY_CASTLE_FACTORY_NAME"
-
com.itextpdf.bouncycastleconnector.logs.BouncyCastleLogMessageConstantModifier and TypeConstant FieldValue
public static final String
"Either com.itextpdf:bouncy-castle-adapter or com.itextpdf:bouncy-castle-fips-adapter dependency must be added in order to use BouncyCastleFactoryCreator"
-
com.itextpdf.commons.actions.AbstractITextEventModifier and TypeConstant FieldValue
private static final String
"AbstractITextEvent is only for internal usage."
-
com.itextpdf.commons.actions.NamespaceConstantModifier and TypeConstant FieldValue
public static final String
"com.itextpdf.barcodes"
public static final String
"com.itextpdf.events"
public static final String
"com.itextpdf.forms"
public static final String
"com.itextpdf.io"
public static final String
"com.itextpdf.kernel"
public static final String
"com.itextpdf.layout"
public static final String
"com.itextpdf.pdfa"
public static final String
"com.itextpdf.pdfua"
public static final String
"com.itextpdf.signatures"
public static final String
"com.itextpdf.svg"
public static final String
"com.itextpdf.styledxmlparser"
public static final String
"com.itextpdf"
public static final String
"com.itextpdf.html2pdf"
public static final String
"com.itextpdf.pdfocr"
public static final String
"com.itextpdf.pdfocr.tesseract4"
public static final String
"com.itextpdf.pdfcleanup"
-
com.itextpdf.commons.actions.com.itextpdf.commons.actions.ProductEventHandler
-
com.itextpdf.commons.actions.ProductNameConstant
-
com.itextpdf.commons.actions.data.CommonsProductData
-
com.itextpdf.commons.actions.producer.com.itextpdf.commons.actions.producer.AbstractFormattedPlaceholderPopulatorModifier and TypeConstant FieldValue
private static final char
'a'
private static final char
'A'
protected static final char
'\''
private static final char
'\\'
private static final char
'z'
private static final char
'Z'
-
com.itextpdf.commons.actions.producer.ProducerBuilderModifier and TypeConstant FieldValue
private static final String
"copyrightSince"
private static final String
"copyrightTo"
private static final String
"currentDate"
private static final char
':'
private static final String
"; modified using "
private static final String
"\\$\\{([^}]*)\\}"
private static final String
"usedProducts"
-
com.itextpdf.commons.actions.producer.com.itextpdf.commons.actions.producer.UsedProductsPlaceholderPopulatorModifier and TypeConstant FieldValue
private static final char
'P'
private static final String
", "
private static final char
'T'
private static final char
'V'
-
com.itextpdf.commons.exceptions.AggregatedException
-
com.itextpdf.commons.exceptions.CommonsExceptionMessageConstantModifier and TypeConstant FieldValue
public static final String
"Element already has sequence id: {0}, new id {1} will be ignored"
public static final String
"File name: {0}, already exists."
public static final String
"File name can not be null."
public static final String
"File name should be unique."
public static final String
"File should exist."
public static final String
"Invalid usage of placeholder \"{0}\": any configuration is forbidden"
public static final String
"Invalid usage of placeholder \"{0}\": format is required"
public static final String
"Passed json object can not be null"
public static final String
"No events were registered for the document!"
public static final String
"Pattern contains open quotation!"
public static final String
"Pattern contains unexpected character {0}"
public static final String
"Pattern contains unexpected component {0}"
public static final String
"Product name can not be null."
public static final String
"Passed stream can not be null"
public static final String
"Unknown ITextException."
public static final String
"Zip entry not found for name: {0}"
-
com.itextpdf.commons.exceptions.UnknownProductExceptionModifier and TypeConstant FieldValue
public static final String
"Product {0} is unknown. Probably you have to register it."
-
com.itextpdf.commons.logs.CommonsLogMessageConstantModifier and TypeConstant FieldValue
public static final String
"Exception during base64 encoding or decoding."
public static final String
"Statistics name {0} is invalid. Cannot find corresponding statistics aggregator."
public static final String
"Cannot archive files into zip. Exception message: {0}."
public static final String
"Ratio between compressed and uncompressed data is highly suspicious, looks like a Zip Bomb Attack. Threshold ratio is {0}."
public static final String
"Too much entries in this archive, can lead to inodes exhaustion of the system, looks like a Zip Bomb Attack. Threshold number of file entries is {0}."
public static final String
"Unable to deserialize json. Exception {0} was thrown with the message: {1}."
public static final String
"Unable to serialize object. Exception {0} was thrown with the message: {1}."
public static final String
"The uncompressed data size is too much for the application resource capacity, looks like a Zip Bomb Attack. Threshold size is {0}."
public static final String
"Unknown placeholder {0} was ignored"
public static final String
"Event for the product {0} with type {1} attempted to be confirmed but it had not been reported yet. Probably appropriate process fail"
-
com.itextpdf.commons.utils.Base64Modifier and TypeConstant FieldValue
public static final int
0
public static final int
8
public static final int
1
private static final byte
0x3d
private static final byte
0xff
public static final int
2
private static final int
76
private static final byte
0xa
public static final int
0
public static final int
32
private static final String
"UTF-8"
public static final int
16
private static final byte
0xfb
-
com.itextpdf.commons.utils.DateTimeUtil
-
com.itextpdf.commons.utils.EncodingUtil
-
com.itextpdf.commons.utils.MapUtil
-
com.itextpdf.commons.utils.PlaceHolderTextUtilModifier and TypeConstant FieldValue
private static final String
"Portable Document Format (PDF), standardized as ISO 32000, is a file format developed by Adobe in 1992 to present documents, including text formatting and images, in a manner independent of application software, hardware, and operating systems. Based on the PostScript language, each PDF file encapsulates a complete description of a fixed-layout flat document, including the text, fonts, vector graphics, raster images and other information needed to display it. PDF has its roots in \"The Camelot Project\" initiated by Adobe co-founder John Warnock in 1991. PDF was standardized as ISO 32000 in 2008. The last edition as ISO 32000-2:2020 was published in December 2020. PDF files may contain a variety of content besides flat text and graphics including logical structuring elements, interactive elements such as annotations and form-fields, layers, rich media (including video content), three-dimensional objects using U3D or PRC, and various other data formats. The PDF specification also provides for encryption and digital signatures, file attachments, and metadata to enable workflows requiring these features. History Main article: History of PDF Adobe Systems made the PDF specification available free of charge in 1993. In the early years PDF was popular mainly in desktop publishing workflows, and competed with a variety of formats such as DjVu, Envoy, Common Ground Digital Paper, Farallon Replica and even Adobe\'s own PostScript format. PDF was a proprietary format controlled by Adobe until it was released as an open standard on July 1, 2008, and published by the International Organization for Standardization as ISO 32000-1:2008, at which time control of the specification passed to an ISO Committee of volunteer industry experts. In 2008, Adobe published a Public Patent License to ISO 32000-1 granting royalty-free rights for all patents owned by Adobe that are necessary to make, use, sell, and distribute PDF-compliant implementations. PDF 1.7, the sixth edition of the PDF specification that became ISO 32000-1, includes some proprietary technologies defined only by Adobe, such as Adobe XML Forms Architecture (XFA) and JavaScript extension for Acrobat, which are referenced by ISO 32000-1 as normative and indispensable for the full implementation of the ISO 32000-1 specification. These proprietary technologies are not standardized and their specification is published only on Adobe\'s website. Many of them are also not supported by popular third-party implementations of PDF. In December 2020, the second edition of PDF 2.0, ISO 32000-2:2020, was published, including clarifications, corrections, and critical updates to normative references. ISO 32000-2 does not include any proprietary technologies as normative references. ISO\'s publication of ISO 32000-2 in 2017 ended the 24-year tradition of the latest PDF specification being freely available from Adobe. Starting in April, 2023, to provide PDF developers and stakeholders with their accustomed level of access, the PDF Association and its sponsors made ISO 32000-2 available for download at no cost. Technical details A PDF file is often a combination of vector graphics, text, and bitmap graphics. The basic types of content in a PDF are: Typeset text stored as content streams (i.e., not encoded in plain text); Vector graphics for illustrations and designs that consist of shapes and lines; Raster graphics for photographs and other types of images Multimedia objects in the document. In later PDF revisions, a PDF document can also support links (inside document or web page), forms, JavaScript (initially available as a plugin for Acrobat 3.0), or any other types of embedded contents that can be handled using plug-ins. PDF combines three technologies: An equivalent subset of the PostScript page description programming language but in declarative form, for generating the layout and graphics. A font-embedding/replacement system to allow fonts to travel with the documents. A structured storage system to bundle these elements and any associated content into a single file, with data compression where appropriate. PostScript language PostScript is a page description language run in an interpreter to generate an image, a process requiring many resources. It can handle graphics and standard features of programming languages such as if statements and loop commands. PDF is largely based on PostScript but simplified to remove flow control features like these, while graphics commands equivalent to lineto remain. Historically, the PostScript-like PDF code is generated from a source PostScript file. The graphics commands that are output by the PostScript code are collected and tokenized.[clarification needed] Any files, graphics, or fonts to which the document refers also are collected. Then, everything is compressed to a single file. Therefore, the entire PostScript world (fonts, layout, measurements) remains intact.[citation needed] As a document format, PDF has several advantages over PostScript: PDF contains tokenized and interpreted results of the PostScript source code, for direct correspondence between changes to items in the PDF page description and changes to the resulting page appearance. PDF (since version 1.4) supports transparent graphics; PostScript does not. PostScript is an interpreted programming language with an implicit global state, so instructions accompanying the description of one page can affect the appearance of any following page. Therefore, all preceding pages in a PostScript document must be processed to determine the correct appearance of a given page, whereas each page in a PDF document is unaffected by the others. As a result, PDF viewers allow the user to quickly jump to the final pages of a long document, whereas a PostScript viewer needs to process all pages sequentially before being able to display the destination page (unless the optional PostScript Document Structuring Conventions have been carefully compiled and included). PDF 1.6 and later supports interactive 3D documents embedded in a PDF file: 3D drawings can be embedded using U3D or PRC and various other data formats. File format A PDF file is organized using ASCII characters, except for certain elements that may have binary content. The file starts with a header containing a magic number (as a readable string) and the version of the format, for example %PDF-1.7. The format is a subset of a COS (\"Carousel\" Object Structure) format. A COS tree file consists primarily of objects, of which there are nine types: Boolean values, representing true or false Real numbers Integers Strings, enclosed within parentheses ((...)) or represented as hexadecimal within single angle brackets (<...>). Strings may contain 8-bit characters. Names, starting with a forward slash (/) Arrays, ordered collections of objects enclosed within square brackets ([...]) Dictionaries, collections of objects indexed by names enclosed within double angle brackets (<<...>>) Streams, usually containing large amounts of optionally compressed binary data, preceded by a dictionary and enclosed between the stream and endstream keywords. The null object Furthermore, there may be comments, introduced with the percent sign (%). Comments may contain 8-bit characters. Objects may be either direct (embedded in another object) or indirect. Indirect objects are numbered with an object number and a generation number and defined between the obj and endobj keywords if residing in the document root. Beginning with PDF version 1.5, indirect objects (except other streams) may also be located in special streams known as object streams (marked /Type /ObjStm). This technique enables non-stream objects to have standard stream filters applied to them, reduces the size of files that have large numbers of small indirect objects and is especially useful for Tagged PDF. Object streams do not support specifying an object\'s generation number (other than 0). An index table, also called the cross-reference table, is located near the end of the file and gives the byte offset of each indirect object from the start of the file. This design allows for efficient random access to the objects in the file, and also allows for small changes to be made without rewriting the entire file (incremental update). Before PDF version 1.5, the table would always be in a special ASCII format, be marked with the xref keyword, and follow the main body composed of indirect objects. Version 1.5 introduced optional cross-reference streams, which have the form of a standard stream object, possibly with filters applied. Such a stream may be used instead of the ASCII cross-reference table and contains the offsets and other information in binary format. The format is flexible in that it allows for integer width specification (using the /W array), so that for example, a document not exceeding 64 KiB in size may dedicate only 2 bytes for object offsets. At the end of a PDF file is a footer containing The startxref keyword followed by an offset to the start of the cross-reference table (starting with the xref keyword) or the cross-reference stream object, followed by The %%EOF end-of-file marker. If a cross-reference stream is not being used, the footer is preceded by the trailer keyword followed by a dictionary containing information that would otherwise be contained in the cross-reference stream object\'s dictionary: A reference to the root object of the tree structure, also known as the catalog (/Root) The count of indirect objects in the cross-reference table (/Size) Other optional information Within each page, there are one or multiple content streams that describe the text, vector and images being drawn on the page. The content stream is stack-based, similar to PostScript. The maximum size of a PDF compared to Europe. There are two layouts to the PDF files: non-linearized (not \"optimized\") and linearized (\"optimized\"). Non-linearized PDF files can be smaller than their linear counterparts, though they are slower to access because portions of the data required to assemble pages of the document are scattered throughout the PDF file. Linearized PDF files (also called \"optimized\" or \"web optimized\" PDF files) are constructed in a manner that enables them to be read in a Web browser plugin without waiting for the entire file to download, since all objects required for the first page to display are optimally organized at the start of the file. PDF files may be optimized using Adobe Acrobat software or QPDF. Page dimensions are not limited by the format itself. However, Adobe Acrobat imposes a limit of 15 million in by 15 million in, or 225 trillion in2 (145,161 km2). Imaging model The basic design of how graphics are represented in PDF is very similar to that of PostScript, except for the use of transparency, which was added in PDF 1.4. PDF graphics use a device-independent Cartesian coordinate system to describe the surface of a page. A PDF page description can use a matrix to scale, rotate, or skew graphical elements. A key concept in PDF is that of the graphics state, which is a collection of graphical parameters that may be changed, saved, and restored by a page description. PDF has (as of version 2.0) 25 graphics state properties, of which some of the most important are: The current transformation matrix (CTM), which determines the coordinate system The clipping path The color space The alpha constant, which is a key component of transparency Black point compensation control (introduced in PDF 2.0) Vector graphics As in PostScript, vector graphics in PDF are constructed with paths. Paths are usually composed of lines and cubic B\u00e9zier curves, but can also be constructed from the outlines of text. Unlike PostScript, PDF does not allow a single path to mix text outlines with lines and curves. Paths can be stroked, filled, fill then stroked, or used for clipping. Strokes and fills can use any color set in the graphics state, including patterns. PDF supports several types of patterns. The simplest is the tiling pattern in which a piece of artwork is specified to be drawn repeatedly. This may be a colored tiling pattern, with the colors specified in the pattern object, or an uncolored tiling pattern, which defers color specification to the time the pattern is drawn. Beginning with PDF 1.3 there is also a shading pattern, which draws continuously varying colors. There are seven types of shading patterns of which the simplest are the axial shading (Type 2) and radial shading (Type 3). Raster images Raster images in PDF (called Image XObjects) are represented by dictionaries with an associated stream. The dictionary describes the properties of the image, and the stream contains the image data. (Less commonly, small raster images may be embedded directly in a page description as an inline image.) Images are typically filtered for compression purposes. Image filters supported in PDF include the following general-purpose filters: ASCII85Decode, a filter used to put the stream into 7-bit ASCII, ASCIIHexDecode, similar to ASCII85Decode but less compact, FlateDecode, a commonly used filter based on the deflate algorithm defined in RFC 1951 (deflate is also used in the gzip, PNG, and zip file formats among others); introduced in PDF 1.2; it can use one of two groups of predictor functions for more compact zlib/deflate compression: Predictor 2 from the TIFF 6.0 specification and predictors (filters) from the PNG specification (RFC 2083), LZWDecode, a filter based on LZW Compression; it can use one of two groups of predictor functions for more compact LZW compression: Predictor 2 from the TIFF 6.0 specification and predictors (filters) from the PNG specification, RunLengthDecode, a simple compression method for streams with repetitive data using the run-length encoding algorithm and the image-specific filters, DCTDecode, a lossy filter based on the JPEG standard, CCITTFaxDecode, a lossless bi-level (black/white) filter based on the Group 3 or Group 4 CCITT (ITU-T) fax compression standard defined in ITU-T T.4 and T.6, JBIG2Decode, a lossy or lossless bi-level (black/white) filter based on the JBIG2 standard, introduced in PDF 1.4, and JPXDecode, a lossy or lossless filter based on the JPEG 2000 standard, introduced in PDF 1.5. Normally all image content in a PDF is embedded in the file. But PDF allows image data to be stored in external files by the use of external streams or Alternate Images. Standardized subsets of PDF, including PDF/A and PDF/X, prohibit these features. Text Text in PDF is represented by text elements in page content streams. A text element specifies that characters should be drawn at certain positions. The characters are specified using the encoding of a selected font resource. A font object in PDF is a description of a digital typeface. It may either describe the characteristics of a typeface, or it may include an embedded font file. The latter case is called an embedded font while the former is called an unembedded font. The font files that may be embedded are based on widely used standard digital font formats: Type 1 (and its compressed variant CFF), TrueType, and (beginning with PDF 1.6) OpenType. Additionally PDF supports the Type 3 variant in which the components of the font are described by PDF graphic operators. Fourteen typefaces, known as the standard 14 fonts, have a special significance in PDF documents: Times (v3) (in regular, italic, bold, and bold italic) Courier (in regular, oblique, bold and bold oblique) Helvetica (v3) (in regular, oblique, bold and bold oblique) Symbol Zapf Dingbats These fonts are sometimes called the base fourteen fonts. These fonts, or suitable substitute fonts with the same metrics, should be available in most PDF readers, but they are not guaranteed to be available in the reader, and may only display correctly if the system has them installed. Fonts may be substituted if they are not embedded in a PDF. Within text strings, characters are shown using character codes (integers) that map to glyphs in the current font using an encoding. There are several predefined encodings, including WinAnsi, MacRoman, and many encodings for East Asian languages and a font can have its own built-in encoding. (Although the WinAnsi and MacRoman encodings are derived from the historical properties of the Windows and Macintosh operating systems, fonts using these encodings work equally well on any platform.) PDF can specify a predefined encoding to use, the font\'s built-in encoding or provide a lookup table of differences to a predefined or built-in encoding (not recommended with TrueType fonts). The encoding mechanisms in PDF were designed for Type 1 fonts, and the rules for applying them to TrueType fonts are complex. For large fonts or fonts with non-standard glyphs, the special encodings Identity-H (for horizontal writing) and Identity-V (for vertical) are used. With such fonts, it is necessary to provide a ToUnicode table if semantic information about the characters is to be preserved. Transparency The original imaging model of PDF was, like PostScript\'s, opaque: each object drawn on the page completely replaced anything previously marked in the same location. In PDF 1.4 the imaging model was extended to allow transparency. When transparency is used, new objects interact with previously marked objects to produce blending effects. The addition of transparency to PDF was done by means of new extensions that were designed to be ignored in products written to PDF 1.3 and earlier specifications. As a result, files that use a small amount of transparency might view acceptably by older viewers, but files making extensive use of transparency could be viewed incorrectly by an older viewer. The transparency extensions are based on the key concepts of transparency groups, blending modes, shape, and alpha. The model is closely aligned with the features of Adobe Illustrator version 9. The blend modes were based on those used by Adobe Photoshop at the time. When the PDF 1.4 specification was published, the formulas for calculating blend modes were kept secret by Adobe. They have since been published. The concept of a transparency group in PDF specification is independent of existing notions of \"group\" or \"layer\" in applications such as Adobe Illustrator. Those groupings reflect logical relationships among objects that are meaningful when editing those objects, but they are not part of the imaging model. Additional features Logical structure and accessibility A \"tagged\" PDF (see clause 14.8 in ISO 32000) includes document structure and semantics information to enable reliable text extraction and accessibility. Technically speaking, tagged PDF is a stylized use of the format that builds on the logical structure framework introduced in PDF 1.3. Tagged PDF defines a set of standard structure types and attributes that allow page content (text, graphics, and images) to be extracted and reused for other purposes. Tagged PDF is not required in situations where a PDF file is intended only for print. Since the feature is optional, and since the rules for Tagged PDF were relatively vague in ISO 32000-1, support for tagged PDF among consuming devices, including assistive technology (AT), is uneven as of 2021. ISO 32000-2, however, includes an improved discussion of tagged PDF which is anticipated to facilitate further adoption. An ISO-standardized subset of PDF specifically targeted at accessibility, PDF/UA, was first published in 2012. Optional Content Groups (layers) With the introduction of PDF version 1.5 (2003) came the concept of Layers. Layers, more formally known as Optional Content Groups (OCGs), refer to sections of content in a PDF document that can be selectively viewed or hidden by document authors or viewers. This capability is useful in CAD drawings, layered artwork, maps, multi-language documents, etc. Basically, it consists of an Optional Content Properties Dictionary added to the document root. This dictionary contains an array of Optional Content Groups (OCGs), each describing a set of information and each of which may be individually displayed or suppressed, plus a set of Optional Content Configuration Dictionaries, which give the status (Displayed or Suppressed) of the given OCGs. Encryption and signatures A PDF file may be encrypted, for security, in which case a password is needed to view or edit the contents. PDF 2.0 defines 256-bit AES encryption as standard for PDF 2.0 files. The PDF Reference also defines ways that third parties can define their own encryption systems for PDF. PDF files may be digitally signed, to provide secure authentication; complete details on implementing digital signatures in PDF is provided in ISO 32000-2. PDF files may also contain embedded DRM restrictions that provide further controls that limit copying, editing, or printing. These restrictions depend on the reader software to obey them, so the security they provide is limited. The standard security provided by PDF consists of two different methods and two different passwords: a user password, which encrypts the file and prevents opening, and an owner password, which specifies operations that should be restricted even when the document is decrypted, which can include modifying, printing, or copying text and graphics out of the document, or adding or modifying text notes and AcroForm fields. The user password encrypts the file, while the owner password does not, instead relying on client software to respect these restrictions. An owner password can easily be removed by software, including some free online services. Thus, the use restrictions that a document author places on a PDF document are not secure, and cannot be assured once the file is distributed; this warning is displayed when applying such restrictions using Adobe Acrobat software to create or edit PDF files. Even without removing the password, most freeware or open source PDF readers ignore the permission \"protections\" and allow the user to print or make copy of excerpts of the text as if the document were not limited by password protection. Beginning with PDF 1.5, Usage rights (UR) signatures are used to enable additional interactive features that are not available by default in a particular PDF viewer application. The signature is used to validate that the permissions have been granted by a bona fide granting authority. For example, it can be used to allow a user: To save the PDF document along with a modified form or annotation data Import form data files in FDF, XFDF, and text (CSV/TSV) formats Export form data files in FDF and XFDF formats Submit form data Instantiate new pages from named page templates Apply a digital signature to existing digital signature form field Create, delete, modify, copy, import, and export annotations For example, Adobe Systems grants permissions to enable additional features in Adobe Reader, using public-key cryptography. Adobe Reader verifies that the signature uses a certificate from an Adobe-authorized certificate authority. Any PDF application can use this same mechanism for its own purposes. Under specific circumstances including non-patched systems of the receiver, the information the receiver of a digital signed document sees can be manipulated by the sender after the document has been signed by the signer. PAdES (PDF Advanced Electronic Signatures) is a set of restrictions and extensions to PDF and ISO 32000-1 making it suitable for advanced electronic signatures. This is published by ETSI as TS 102 778. File attachments PDF files can have file attachments which processors may access and open or save to a local filesystem. Metadata PDF files can contain two types of metadata. The first is the Document Information Dictionary, a set of key/value fields such as author, title, subject, creation and update dates. This is optional and is referenced from an Info key in the trailer of the file. A small set of fields is defined and can be extended with additional text values if required. This method is deprecated in PDF 2.0. In PDF 1.4, support was added for Metadata Streams, using the Extensible Metadata Platform (XMP) to add XML standards-based extensible metadata as used in other file formats. PDF 2.0 allows metadata to be attached to any object in the document, such as information about embedded illustrations, fonts, and images, as well as the whole document (attaching to the document catalog), using an extensible schema. PDF documents can also contain display settings, including the page display layout and zoom level in a Viewer Preferences object. Adobe Reader uses these settings to override the user\'s default settings when opening the document. The free Adobe Reader cannot remove these settings. Accessibility PDF files can be created specifically to be accessible for people with disabilities. PDF file formats in use as of 2014 can include tags, text equivalents, captions, audio descriptions, and more. Some software can automatically produce tagged PDFs, but this feature is not always enabled by default. Leading screen readers, including JAWS, Window-Eyes, Hal, and Kurzweil 1000 and 3000 can read tagged PDF. Moreover, tagged PDFs can be re-flowed and magnified for readers with visual impairments. Adding tags to older PDFs and those that are generated from scanned documents can present some challenges. One of the significant challenges with PDF accessibility is that PDF documents have three distinct views, which, depending on the document\'s creation, can be inconsistent with each other. The three views are (i) the physical view, (ii) the tags view, and (iii) the content view. The physical view is displayed and printed (what most people consider a PDF document). The tags view is what screen readers and other assistive technologies use to deliver high-quality navigation and reading experience to users with disabilities. The content view is based on the physical order of objects within the PDF\'s content stream and may be displayed by software that does not fully support the tags\' view, such as the Reflow feature in Adobe\'s Reader. PDF/UA, the International Standard for accessible PDF based on ISO 32000-1 was first published as ISO 14289\u20131 in 2012 and establishes normative language for accessible PDF technology. Multimedia Rich Media PDF is a PDF file including interactive content that can be embedded or linked within the file. It can contain images, audio, video content, or buttons. For example, if the interactive PDF is a digital catalog for an E-commerce business, products can be listed on the PDF pages and can be added with images and links to the website and buttons to order directly from the document. Forms Interactive Forms is a mechanism to add forms to the PDF file format. PDF currently supports two different methods for integrating data and PDF forms. Both formats today coexist in the PDF specification: AcroForms (also known as Acrobat forms), introduced in the PDF 1.2 format specification and included in all later PDF specifications. XML Forms Architecture (XFA) forms, introduced in the PDF 1.5 format specification. Adobe XFA Forms are not compatible with AcroForms. XFA was deprecated from PDF with PDF 2.0. AcroForms were introduced in the PDF 1.2 format. AcroForms permit using objects (e.g. text boxes, Radio buttons, etc.) and some code (e.g. JavaScript). Alongside the standard PDF action types, interactive forms (AcroForms) support submitting, resetting, and importing data. The \"submit\" action transmits the names and values of selected interactive form fields to a specified uniform resource locator (URL). Interactive form field names and values may be submitted in any of the following formats, (depending on the settings of the action\'s ExportFormat, SubmitPDF, and XFDF flags): HTML Form format HTML 4.01 Specification since PDF 1.5; HTML 2.0 since 1.2 Forms Data Format (FDF) based on PDF, uses the same syntax and has essentially the same file structure, but is much simpler than PDF since the body of an FDF document consists of only one required object. Forms Data Format is defined in the PDF specification (since PDF 1.2). The Forms Data Format can be used when submitting form data to a server, receiving the response, and incorporating it into the interactive form. It can also be used to export form data to stand-alone files that can be imported back into the corresponding PDF interactive form. FDF was originally defined in 1996 as part of ISO 32000-2:2017.[citation needed] XML Forms Data Format (XFDF) (external XML Forms Data Format Specification, Version 2.0; supported since PDF 1.5; it replaced the \"XML\" form submission format defined in PDF 1.4) the XML version of Forms Data Format, but the XFDF implements only a subset of FDF containing forms and annotations. Some entries in the FDF dictionary do not have XFDF equivalents \u2013 such as the Status, Encoding, JavaScript, Page\'s keys, EmbeddedFDFs, Differences, and Target. In addition, XFDF does not allow the spawning, or addition, of new pages based on the given data; as can be done when using an FDF file. The XFDF specification is referenced (but not included) in PDF 1.5 specification (and in later versions). It is described separately in XML Forms Data Format Specification. The PDF 1.4 specification allowed form submissions in XML format, but this was replaced by submissions in XFDF format in the PDF 1.5 specification. XFDF conforms to the XML standard. XFDF can be used in the same way as FDF; e.g., form data is submitted to a server, modifications are made, then sent back and the new form data is imported in an interactive form. It can also be used to export form data to stand-alone files that can be imported back into the corresponding PDF interactive form. As of August 2019, XFDF 3.0 is an ISO/IEC standard under the formal name ISO 19444-1:2019 - Document management \u2014 XML Forms Data Format \u2014 Part 1: Use of ISO 32000-2 (XFDF 3.0). This standard is a normative reference of ISO 32000-2. PDF The entire document can be submitted rather than individual fields and values, as was defined in PDF 1.4. AcroForms can keep form field values in external stand-alone files containing key-value pairs. The external files may use Forms Data Format (FDF) and XML Forms Data Format (XFDF) files. The usage rights (UR) signatures define rights for import form data files in FDF, XFDF, and text (CSV/TSV) formats, and export form data files in FDF and XFDF formats. In PDF 1.5, Adobe Systems introduced a proprietary format for forms; Adobe XML Forms Architecture (XFA). Adobe XFA Forms are not compatible with ISO 32000\'s AcroForms feature, and most PDF processors do not handle XFA content. The XFA specification is referenced from ISO 32000-1/PDF 1.7 as an external proprietary specification and was entirely deprecated from PDF with ISO 32000-2 (PDF 2.0). Split and merge PDF files can be splitted and merged, using applications. Licensing Anyone may create applications that can read and write PDF files without having to pay royalties to Adobe Systems; Adobe holds patents to PDF, but licenses them for royalty-free use in developing software complying with its PDF specification. "
-
com.itextpdf.commons.utils.SystemUtilModifier and TypeConstant FieldValue
private static final String
"((\".+?\"|[^\'\\s]|\'.+?\')+)\\s*"
-
com.itextpdf.forms.FormDefaultAccessibilityPropertiesModifier and TypeConstant FieldValue
private static final String
"Checked"
private static final String
"off"
private static final String
"on"
public static final String
"cb"
public static final String
"lb"
public static final String
"pb"
public static final String
"rb"
public static final String
"tv"
private static final String
"PrintField"
private static final String
"Role"
-
com.itextpdf.forms.PdfAcroFormModifier and TypeConstant FieldValue
public static final int
2
public static final int
1
-
com.itextpdf.forms.exceptions.FormsExceptionMessageConstantModifier and TypeConstant FieldValue
public static final String
"Appearance name must be provided"
public static final String
"Cannot merge form fields with the same names. Partial name is {0}. Field dictionaries with the same fully qualified field name shall have the same field type (FT), value (V), and default value (DV)."
public static final String
"Unsupported checkbox type for PDF/A"
public static final String
"Radio group name cannot be empty."
public static final String
"Field flattening is not supported in append mode."
public static final String
"Field name {0} already exists in the form."
public static final String
"Form field must have a name. Set it using PdfFormField#setFieldName call."
public static final String
"Index: {0}, Size: {1}"
public static final String
"Inner arrays shall have exactly two elements"
public static final String
"Invalid rotation. Rotation must be a multiple of 90 degrees."
public static final String
"Option element must be a string or an array"
public static final String
"Option element shall not be null."
public static final String
"The page has been already flushed. Use PdfAcroForm#addFieldAppearanceToPage() method before page flushing."
public static final String
"Invalid formfield type: {0}, only following values are allowed {1}."
public static final String
"Separator should be a valid value. Values that are not allowed are null,empty string, or . "
public static final String
"Value <{0}> shall not be null"
public static final String
"Widget rectangle must be provided"
-
com.itextpdf.forms.exceptions.XfdfException
-
com.itextpdf.forms.fields.AbstractPdfFormFieldModifier and TypeConstant FieldValue
private static final int
2
private static final int
0
private static final int
1
public static final int
12
public static final int
4
-
com.itextpdf.forms.fields.PdfFormAnnotationModifier and TypeConstant FieldValue
private static final float
9.999999747378752E-5f
public static final int
1
public static final int
3
private static final String
"\\r\\n|\\r|\\n"
public static final String
"Off"
public static final String
"Yes"
public static final int
4
public static final int
2
-
com.itextpdf.forms.fields.TextFormFieldBuilder
-
com.itextpdf.forms.fields.borders.com.itextpdf.forms.fields.borders.AbstractFormBorderModifier and TypeConstant FieldValue
static final int
1002
static final int
1003
static final int
1001
-
com.itextpdf.forms.fields.merging.AddIndexStrategy
-
com.itextpdf.forms.form.FormPropertyModifier and TypeConstant FieldValue
public static final int
2097163
public static final int
2097166
public static final int
2097167
public static final int
2097159
public static final int
2097157
public static final int
2097153
public static final int
2097162
public static final int
2097160
public static final int
2097156
public static final int
2097165
public static final int
2097164
public static final int
2097158
public static final int
2097161
public static final int
2097154
public static final int
2097155
private static final int
2097152
-
com.itextpdf.forms.form.element.InputField
-
com.itextpdf.forms.form.element.SignatureFieldAppearance
-
com.itextpdf.forms.form.element.TextArea
-
com.itextpdf.forms.form.renderer.ButtonRendererModifier and TypeConstant FieldValue
private static final float
4.0f
private static final float
0.15000000596046448f
-
com.itextpdf.forms.form.renderer.CheckBoxRendererModifier and TypeConstant FieldValue
public static final float
0.75f
private static final float
8.25f
-
com.itextpdf.forms.form.renderer.RadioRenderer
-
com.itextpdf.forms.form.renderer.SignatureAppearanceRendererModifier and TypeConstant FieldValue
private static final float
9.999999747378752E-6f
private static final float
0.30000001192092896f
-
com.itextpdf.forms.logs.FormsLogMessageConstantsModifier and TypeConstant FieldValue
public static final String
"AcroForm fields creation for select fields (ComboBoxField and ListBoxField) is not supported. They will be flattened instead."
public static final String
"Annotation is noticed directly in fields array of AcroForm dictionary. It violates pdf specification."
public static final String
"Cannot create form field from a given PDF object: {0}"
public static final String
"Cannot merge form fields with the same fully qualified names. Partial name is {0}. Field type (FT), value (V), and default value (DV) should be the same"
public static final String
"Shouldn\'t come here because then we should have taken default size"
public static final String
"More than one option with the same value. This is an invalid state."
public static final String
"Cannot layout form field. It won\'t be displayed"
public static final String
"Error during layout of form field with type {0}."
public static final String
"Field value cannot be null."
public static final String
"Fieldname: <{0}> not found. Operation can not be completed."
public static final String
"Form field must have a name. Set it using PdfFormField#setFieldName call."
public static final String
"A form field was flushed. There\'s no way to create this field in the AcroForm dictionary."
public static final String
"Encountered a page rotation that was not a multiple of 90\u00b0/ (Pi/2) when generating default appearances for form fields"
public static final String
"Encountered a widget rotation that was not a multiple of 90\u00b0/ (Pi/2) when generating default appearances for form fields"
public static final String
"Input field doesn\'t fit in outer object. It will be clipped"
public static final String
"Value \'{0}\': <{1}> invalid. Default value will be used."
public static final String
"\\N entry is required to be present in an appearance dictionary."
public static final String
"Required AcroForm entry /Fields does not exist in the document. Empty array /Fields will be created."
public static final String
"No form field name provided. Process will not be continued."
public static final String
"Radiobutton was added without defining rectangle, it will not be displayed"
public static final String
"Unsupported color in FormField\'s DA"
-
com.itextpdf.forms.util.DrawingUtilModifier and TypeConstant FieldValue
protected static final String
"0.8 0 0 0.8 0.3 0.5 cm 0 0 m\n0.066 -0.026 l\n0.137 -0.15 l\n0.259 0.081 0.46 0.391 0.553 0.461 c\n0.604 0.489 l\n0.703 0.492 l\n0.543 0.312 0.255 -0.205 0.154 -0.439 c\n0.069 -0.399 l\n0.035 -0.293 -0.039 -0.136 -0.091 -0.057 c\nh\nf\n"
protected static final String
"1 0 0 1 0.86 0.5 cm 0 0 m\n0 0.204 -0.166 0.371 -0.371 0.371 c\n-0.575 0.371 -0.741 0.204 -0.741 0 c\n-0.741 -0.204 -0.575 -0.371 -0.371 -0.371 c\n-0.166 -0.371 0 -0.204 0 0 c\nf\n"
protected static final String
"1 0 0 1 0.80 0.8 cm 0 0 m\n-0.172 -0.027 l\n-0.332 -0.184 l\n-0.443 -0.019 l\n-0.475 -0.009 l\n-0.568 -0.168 l\n-0.453 -0.324 l\n-0.58 -0.497 l\n-0.59 -0.641 l\n-0.549 -0.627 l\n-0.543 -0.612 -0.457 -0.519 -0.365 -0.419 c\n-0.163 -0.572 l\n-0.011 -0.536 l\n-0.004 -0.507 l\n-0.117 -0.441 l\n-0.246 -0.294 l\n-0.132 -0.181 l\n0.031 -0.04 l\nh\nf\n"
protected static final String
"1 0 0 1 0.5 0.12 cm 0 0 m\n0.376 0.376 l\n0 0.751 l\n-0.376 0.376 l\nh\nf\n"
protected static final String
"1 0 0 1 0.835 0.835 cm 0 0 -0.669 -0.67 re\nf\n"
protected static final String
"0.95 0 0 0.95 0.85 0.6 cm 0 0 m\n-0.291 0 l\n-0.381 0.277 l\n-0.47 0 l\n-0.761 0 l\n-0.526 -0.171 l\n-0.616 -0.448 l\n-0.381 -0.277 l\n-0.145 -0.448 l\n-0.236 -0.171 l\nh\nf\n"
-
com.itextpdf.forms.xfa.XfaFormModifier and TypeConstant FieldValue
private static final int
16384
public static final String
"http://www.xfa.org/schema/xfa-data/1.0/"
-
com.itextpdf.forms.xfdf.XfdfConstantsModifier and TypeConstant FieldValue
public static final String
"Action"
public static final String
"annot"
public static final String
"annots"
public static final String
"appearance"
public static final String
"BorderStyleAlt"
public static final String
"Bottom"
public static final String
"caption"
public static final String
"caption-offset-h"
public static final String
"caption-offset-v"
public static final String
"caption-style"
public static final String
"caret"
public static final String
"circle"
public static final String
"color"
public static final String
"contents"
public static final String
"contents-richtext"
public static final String
"coords"
public static final String
"creationdate"
public static final String
"DashPattern"
public static final String
"dashes"
public static final String
"date"
public static final String
"defaultappearance"
public static final String
"defaultstyle"
public static final String
"Dest"
public static final String
"Empty f element, no href attribute found."
public static final String
"Field has no name attribute."
public static final String
"Field has no value."
public static final String
"Empty ids element, original and/or modified id attributes not found."
public static final String
"end"
public static final String
"f"
public static final String
"field"
public static final String
"fields"
public static final String
"File"
public static final String
"fileattachment"
public static final String
"Fit"
public static final String
"FitB"
public static final String
"FitBH"
public static final String
"FitBV"
public static final String
"FitH"
public static final String
"FitR"
public static final String
"FitV"
public static final String
"flags"
public static final String
"freetext"
public static final String
"fringe"
public static final String
"GoTo"
public static final String
"GoToR"
public static final String
"HCornerRadius"
public static final String
"head"
public static final String
"hidden"
public static final String
"highlight"
public static final String
"href"
public static final String
"icon"
public static final String
"ids"
public static final String
"inreplyto"
public static final String
"ink"
public static final String
"intensity"
public static final String
"intent"
public static final String
"interior-color"
public static final String
"invisible"
public static final String
"IsMap"
public static final String
"justification"
public static final String
"Launch"
public static final String
"leaderExtended"
public static final String
"leaderLength"
public static final String
"leader-offset"
public static final String
"Left"
public static final String
"line"
public static final String
"link"
public static final String
"locked"
public static final String
"modified"
public static final String
"name"
public static final String
"Name"
public static final String
"Named"
public static final String
"NewWindow"
public static final String
"norotate"
public static final String
"noview"
public static final String
"nozoom"
public static final String
"OnActivation"
public static final String
"opacity"
public static final String
"open"
public static final String
"original"
public static final String
"OriginalName"
public static final String
"page"
public static final String
"Page"
public static final String
"polygon"
public static final String
"polyline"
public static final String
"popup"
public static final String
"print"
public static final String
"projection"
public static final String
"readonly"
public static final String
"rect"
public static final String
"redact"
public static final String
"replyType"
public static final String
"Right"
public static final String
"rotation"
public static final String
"sound"
public static final String
"square"
public static final String
"squiggly"
public static final String
"stamp"
public static final String
"start"
public static final String
"state"
public static final String
"statemodel"
public static final String
"strikeout"
public static final String
"style"
public static final String
"subject"
public static final String
"tail"
public static final String
"text"
public static final String
"title"
public static final String
"togglenoview"
public static final String
"Top"
public static final String
"underline"
public static final String
"URI"
public static final String
"VCornerRadius"
public static final String
"value"
public static final String
"vertices"
public static final String
"width"
public static final String
"Width"
public static final String
"xyz"
public static final String
"XYZ"
-
com.itextpdf.io.codec.CCITTG4EncoderModifier and TypeConstant FieldValue
private static final int
1
private static final int
1
private static final int
-3
private static final int
-1
private static final int
-4
private static final int
-2
private static final int
0
private static final int
2
-
com.itextpdf.io.codec.Jbig2SegmentReaderModifier and TypeConstant FieldValue
public static final int
51
public static final int
49
public static final int
50
public static final int
62
public static final int
42
public static final int
38
public static final int
22
public static final int
43
public static final int
39
public static final int
23
public static final int
7
public static final int
6
public static final int
40
public static final int
36
public static final int
20
public static final int
4
public static final int
48
public static final int
16
public static final int
52
public static final int
0
public static final int
53
-
com.itextpdf.io.codec.LZWStringTableModifier and TypeConstant FieldValue
private static final short
-1
private static final short
9973
private static final short
2039
private static final int
12
private static final int
4096
private static final short
-1
private static final int
2
-
com.itextpdf.io.codec.TIFFConstantsModifier and TypeConstant FieldValue
public static final int
0
public static final int
1
public static final int
2
public static final int
5
public static final int
4
public static final int
3
public static final int
2
public static final int
1
public static final int
8
public static final int
3
public static final int
4
public static final int
2
public static final int
32771
public static final int
32947
public static final int
32946
public static final int
32898
public static final int
32895
public static final int
32896
public static final int
32897
public static final int
34661
public static final int
7
public static final int
5
public static final int
32766
public static final int
1
public static final int
6
public static final int
32773
public static final int
32908
public static final int
32909
public static final int
34676
public static final int
34677
public static final int
32809
public static final int
1
public static final int
2
public static final int
0
public static final int
4
public static final int
2
public static final int
1
public static final int
2
public static final int
1
public static final int
5
public static final int
4
public static final int
3
public static final int
2
public static final int
1
public static final int
1
public static final int
4
public static final int
2
public static final int
4
public static final int
2
public static final int
1
public static final int
1
public static final int
14
public static final int
1
public static final int
3
public static final int
2
public static final int
4
public static final int
3
public static final int
8
public static final int
5
public static final int
7
public static final int
6
public static final int
1
public static final int
2
public static final int
8
public static final int
32844
public static final int
32845
public static final int
4
public static final int
1
public static final int
0
public static final int
3
public static final int
2
public static final int
5
public static final int
6
public static final int
1
public static final int
2
public static final int
2
public static final int
1
public static final int
3
public static final int
2
public static final int
1
public static final int
6
public static final int
5
public static final int
3
public static final int
2
public static final int
1
public static final int
4
public static final int
1
public static final int
3
public static final int
2
public static final int
315
public static final int
326
public static final int
258
public static final int
265
public static final int
264
public static final int
327
public static final int
320
public static final int
300
public static final int
259
public static final int
328
public static final int
33432
public static final int
32996
public static final int
306
public static final int
65535
public static final int
269
public static final int
336
public static final int
338
public static final int
34908
public static final int
34910
public static final int
34909
public static final int
34929
public static final int
266
public static final int
34232
public static final int
289
public static final int
288
public static final int
291
public static final int
290
public static final int
292
public static final int
293
public static final int
321
public static final int
316
public static final int
34675
public static final int
32997
public static final int
270
public static final int
257
public static final int
256
public static final int
333
public static final int
332
public static final int
34021
public static final int
34020
public static final int
34024
public static final int
34026
public static final int
34029
public static final int
34017
public static final int
34022
public static final int
34018
public static final int
34023
public static final int
34025
public static final int
34027
public static final int
34019
public static final int
34016
public static final int
34028
public static final int
34750
public static final int
521
public static final int
520
public static final int
514
public static final int
513
public static final int
517
public static final int
518
public static final int
512
public static final int
519
public static final int
515
public static final int
347
public static final int
271
public static final int
32995
public static final int
281
public static final int
280
public static final int
272
public static final int
334
public static final int
274
public static final int
255
public static final int
285
public static final int
297
public static final int
262
public static final int
34377
public static final int
33304
public static final int
33301
public static final int
33300
public static final int
33306
public static final int
33305
public static final int
33302
public static final int
33303
public static final int
284
public static final int
317
public static final int
319
public static final int
532
public static final int
32953
public static final int
32956
public static final int
32954
public static final int
32955
public static final int
296
public static final int
33723
public static final int
278
public static final int
339
public static final int
277
public static final int
341
public static final int
340
public static final int
305
public static final int
37439
public static final int
279
public static final int
273
public static final int
254
public static final int
330
public static final int
337
public static final int
263
public static final int
325
public static final int
32998
public static final int
323
public static final int
324
public static final int
322
public static final int
301
public static final int
318
public static final int
33405
public static final int
286
public static final int
282
public static final int
529
public static final int
531
public static final int
530
public static final int
287
public static final int
283
public static final int
1
public static final int
2
-
com.itextpdf.io.codec.TIFFFieldModifier and TypeConstant FieldValue
public static final int
2
public static final int
1
public static final int
12
public static final int
11
public static final int
4
public static final int
5
public static final int
6
public static final int
3
public static final int
9
public static final int
10
public static final int
8
public static final int
7
-
com.itextpdf.io.codec.brotli.dec.com.itextpdf.io.codec.brotli.dec.BitReaderModifier and TypeConstant FieldValue
private static final int
4160
private static final int
4096
private static final int
1024
private static final int
1040
private static final int
16
-
com.itextpdf.io.codec.brotli.dec.BrotliInputStream
-
com.itextpdf.io.codec.brotli.dec.com.itextpdf.io.codec.brotli.dec.DecodeModifier and TypeConstant FieldValue
private static final int
18
private static final int
16
private static final int
8
private static final int
2
private static final int
8
private static final int
255
private static final int
6
private static final int
26
private static final int
16
private static final int
704
private static final int
256
-
com.itextpdf.io.codec.brotli.dec.DictionaryModifier and TypeConstant FieldValue
static final int
37
static final int
24
static final int
4
-
com.itextpdf.io.codec.brotli.dec.com.itextpdf.io.codec.brotli.dec.DictionaryDataModifier and TypeConstant FieldValue
private static final String
"timedownlifeleftbackcodedatashowonlysitecityopenjustlikefreeworktextyearoverbodyloveformbookplaylivelinehelphomesidemorewordlongthemviewfindpagedaysfullheadtermeachareafromtruemarkableuponhighdatelandnewsevennextcasebothpostusedmadehandherewhatnameLinkblogsizebaseheldmakemainuser\') +holdendswithNewsreadweresigntakehavegameseencallpathwellplusmenufilmpartjointhislistgoodneedwayswestjobsmindalsologorichuseslastteamarmyfoodkingwilleastwardbestfirePageknowaway.pngmovethanloadgiveselfnotemuchfeedmanyrockicononcelookhidediedHomerulehostajaxinfoclublawslesshalfsomesuchzone100%onescareTimeracebluefourweekfacehopegavehardlostwhenparkkeptpassshiproomHTMLplanTypedonesavekeepflaglinksoldfivetookratetownjumpthusdarkcardfilefearstaykillthatfallautoever.comtalkshopvotedeepmoderestturnbornbandfellroseurl(skinrolecomeactsagesmeetgold.jpgitemvaryfeltthensenddropViewcopy1.0\"</a>stopelseliestourpack.gifpastcss?graymean>rideshotlatesaidroadvar feeljohnrickportfast\'UA-dead</b>poorbilltypeU.S.woodmust2px;Inforankwidewantwalllead[0];paulwavesure$(\'#waitmassarmsgoesgainlangpaid!-- lockunitrootwalkfirmwifexml\"songtest20pxkindrowstoolfontmailsafestarmapscorerainflowbabyspansays4px;6px;artsfootrealwikiheatsteptriporg/lakeweaktoldFormcastfansbankveryrunsjulytask1px;goalgrewslowedgeid=\"sets5px;.js?40pxif (soonseatnonetubezerosentreedfactintogiftharm18pxcamehillboldzoomvoideasyringfillpeakinitcost3px;jacktagsbitsrolleditknewnear<!--growJSONdutyNamesaleyou lotspainjazzcoldeyesfishwww.risktabsprev10pxrise25pxBlueding300,ballfordearnwildbox.fairlackverspairjunetechif(!pickevil$(\"#warmlorddoespull,000ideadrawhugespotfundburnhrefcellkeystickhourlossfuel12pxsuitdealRSS\"agedgreyGET\"easeaimsgirlaids8px;navygridtips#999warsladycars); }php?helltallwhomzh:e*/\r\n 100hall.\n\nA7px;pushchat0px;crew*/</hash75pxflatrare && tellcampontolaidmissskiptentfinemalegetsplot400,\r\n\r\ncoolfeet.php<br>ericmostguidbelldeschairmathatom/imgRluckcent000;tinygonehtmlselldrugFREEnodenick?id=losenullvastwindRSS wearrelybeensamedukenasacapewishgulfT23:hitsslotgatekickblurthey15px\'\'););\">msiewinsbirdsortbetaseekT18:ordstreemall60pxfarmb\u0000\u0019sboys[0].\');\"POSTbearkids);}}marytend(UK)quadzh:f-siz----prop\');\rliftT19:viceandydebt>RSSpoolneckblowT16:doorevalT17:letsfailoralpollnovacolsgene b\u0000\u0014softrometillross<h3>pourfadepink<tr>mini)|!(minezh:hbarshear00);milk -->ironfreddiskwentsoilputs/js/holyT22:ISBNT20:adamsees<h2>json\', \'contT21: RSSloopasiamoon</p>soulLINEfortcartT14:<h1>80px!--<9px;T04:mike:46ZniceinchYorkricezh:d\'));puremageparatonebond:37Z_of_\']);000,zh:gtankyardbowlbush:56ZJava30px\n|}\n%C3%:34ZjeffEXPIcashvisagolfsnowzh:iquer.csssickmeatmin.binddellhirepicsrent:36ZHTTP-201fotowolfEND xbox:54ZBODYdick;\n}\nexit:35Zvarsbeat\'});diet999;anne}}</[i].LangkmB2wiretoysaddssealalex;\n\t}echonine.org005)tonyjewssandlegsroof000) 200winegeardogsbootgarycutstyletemption.xmlcockgang$(\'.50pxPh.Dmiscalanloandeskmileryanunixdisc);}\ndustclip).\n\n70px-200DVDs7]><tapedemoi++)wageeurophiloptsholeFAQsasin-26TlabspetsURL bulkcook;}\r\nHEAD[0])abbrjuan(198leshtwin</i>sonyguysfuckpipe|-\n!002)ndow[1];[];\nLog salt\r\n\t\tbangtrimbath){\r\n00px\n});ko:lfeesad>\rs:// [];tollplug(){\n{\r\n .js\'200pdualboat.JPG);\n}quot);\n\n\');\n\r\n}\r201420152016201720182019202020212022202320242025202620272028202920302031203220332034203520362037201320122011201020092008200720062005200420032002200120001999199819971996199519941993199219911990198919881987198619851984198319821981198019791978197719761975197419731972197119701969196819671966196519641963196219611960195919581957195619551954195319521951195010001024139400009999comomC!sesteestaperotodohacecadaaC1obiendC-aasC-vidacasootroforosolootracualdijosidograntipotemadebealgoquC)estonadatrespococasabajotodasinoaguapuesunosantediceluisellamayozonaamorpisoobraclicellodioshoracasiP7P0P=P0P>P<Q\u0000P0Q\u0000Q\u0003Q\u0002P0P=P5P?P>P>Q\u0002P8P7P=P>P4P>Q\u0002P>P6P5P>P=P8Q\u0005P\u001dP0P5P5P1Q\u000bP<Q\u000bP\u0012Q\u000bQ\u0001P>P2Q\u000bP2P>P\u001dP>P>P1P\u001fP>P;P8P=P8P P$P\u001dP5P\u001cQ\u000bQ\u0002Q\u000bP\u001eP=P8P<P4P0P\u0017P0P\u0014P0P\u001dQ\u0003P\u001eP1Q\u0002P5P\u0018P7P5P9P=Q\u0003P<P<P\"Q\u000bQ\u0003P6Y\u0001Y\nX#Y\u0006Y\u0005X\'Y\u0005X9Y\u0003Y\u0004X#Y\bX1X/Y\nX\'Y\u0001Y\tY\u0007Y\bY\u0004Y\u0005Y\u0004Y\u0003X\'Y\bY\u0004Y\u0007X(X3X\'Y\u0004X%Y\u0006Y\u0007Y\nX#Y\nY\u0002X/Y\u0007Y\u0004X+Y\u0005X(Y\u0007Y\u0004Y\bY\u0004Y\nX(Y\u0004X\'Y\nX(Y\u0003X4Y\nX\'Y\u0005X#Y\u0005Y\u0006X*X(Y\nY\u0004Y\u0006X-X(Y\u0007Y\u0005Y\u0005X4Y\bX4firstvideolightworldmediawhitecloseblackrightsmallbooksplacemusicfieldorderpointvalueleveltableboardhousegroupworksyearsstatetodaywaterstartstyledeathpowerphonenighterrorinputabouttermstitletoolseventlocaltimeslargewordsgamesshortspacefocusclearmodelblockguideradiosharewomenagainmoneyimagenamesyounglineslatercolorgreenfront&watchforcepricerulesbeginaftervisitissueareasbelowindextotalhourslabelprintpressbuiltlinksspeedstudytradefoundsenseundershownformsrangeaddedstillmovedtakenaboveflashfixedoftenotherviewschecklegalriveritemsquickshapehumanexistgoingmoviethirdbasicpeacestagewidthloginideaswrotepagesusersdrivestorebreaksouthvoicesitesmonthwherebuildwhichearthforumthreesportpartyClicklowerlivesclasslayerentrystoryusagesoundcourtyour birthpopuptypesapplyImagebeinguppernoteseveryshowsmeansextramatchtrackknownearlybegansuperpapernorthlearngivennamedendedTermspartsGroupbrandusingwomanfalsereadyaudiotakeswhile.com/livedcasesdailychildgreatjudgethoseunitsneverbroadcoastcoverapplefilescyclesceneplansclickwritequeenpieceemailframeolderphotolimitcachecivilscaleenterthemetheretouchboundroyalaskedwholesincestock namefaithheartemptyofferscopeownedmightalbumthinkbloodarraymajortrustcanonunioncountvalidstoneStyleLoginhappyoccurleft:freshquitefilmsgradeneedsurbanfightbasishoverauto;route.htmlmixedfinalYour slidetopicbrownalonedrawnsplitreachRightdatesmarchquotegoodsLinksdoubtasyncthumballowchiefyouthnovel10px;serveuntilhandsCheckSpacequeryjamesequaltwice0,000Startpanelsongsroundeightshiftworthpostsleadsweeksavoidthesemilesplanesmartalphaplantmarksratesplaysclaimsalestextsstarswrong</h3>thing.org/multiheardPowerstandtokensolid(thisbringshipsstafftriedcallsfullyfactsagentThis //-->adminegyptEvent15px;Emailtrue\"crossspentblogsbox\">notedleavechinasizesguest</h4>robotheavytrue,sevengrandcrimesignsawaredancephase><!--en_US'200px_namelatinenjoyajax.ationsmithU.S. holdspeterindianav\">chainscorecomesdoingpriorShare1990sromanlistsjapanfallstrialowneragree</h2>abusealertopera\"-//WcardshillsteamsPhototruthclean.php?saintmetallouismeantproofbriefrow\">genretrucklooksValueFrame.net/-->\n<try {\nvar makescostsplainadultquesttrainlaborhelpscausemagicmotortheir250pxleaststepsCountcouldglasssidesfundshotelawardmouthmovesparisgivesdutchtexasfruitnull,||[];top\">\n<!--POST\"ocean<br/>floorspeakdepth sizebankscatchchart20px;aligndealswould50px;url=\"parksmouseMost ...</amongbrainbody none;basedcarrydraftreferpage_home.meterdelaydreamprovejoint</tr>drugs<!-- aprilidealallenexactforthcodeslogicView seemsblankports (200saved_linkgoalsgrantgreekhomesringsrated30px;whoseparse();\" Blocklinuxjonespixel\');\">);if(-leftdavidhorseFocusraiseboxesTrackement</em>bar\">.src=toweralt=\"cablehenry24px;setupitalysharpminortastewantsthis.resetwheelgirls/css/100%;clubsstuffbiblevotes 1000korea});\r\nbandsqueue= {};80px;cking{\r\n\t\taheadclockirishlike ratiostatsForm\"yahoo)[0];Aboutfinds</h1>debugtasksURL =cells})();12px;primetellsturns0x600.jpg\"spainbeachtaxesmicroangel--></giftssteve-linkbody.});\n\tmount (199FAQ</rogerfrankClass28px;feeds<h1><scotttests22px;drink) || lewisshall#039; for lovedwaste00px;ja:c\u0002simon<fontreplymeetsuntercheaptightBrand) != dressclipsroomsonkeymobilmain.Name platefunnytreescom/\"1.jpgwmodeparamSTARTleft idden, 201);\n}\nform.viruschairtransworstPagesitionpatch<!--\no-cacfirmstours,000 asiani++){adobe\')[0]id=10both;menu .2.mi.png\"kevincoachChildbruce2.jpgURL)+.jpg|suitesliceharry120\" sweettr>\r\nname=diegopage swiss-->\n\n#fff;\">Log.com\"treatsheet) && 14px;sleepntentfiledja:c\u0003id=\"cName\"worseshots-box-delta\n<bears:48Z<data-rural</a> spendbakershops= \"\";php\">ction13px;brianhellosize=o=%2F joinmaybe<img img\">, fjsimg\" \")[0]MTopBType\"newlyDanskczechtrailknows</h5>faq\">zh-cn10);\n-1\");type=bluestrulydavis.js\';>\r\n<!steel you h2>\r\nform jesus100% menu.\r\n\t\r\nwalesrisksumentddingb-likteachgif\" vegasdanskeestishqipsuomisobredesdeentretodospuedeaC1osestC!tienehastaotrospartedondenuevohacerformamismomejormundoaquC-dC-assC3loayudafechatodastantomenosdatosotrassitiomuchoahoralugarmayorestoshorastenerantesfotosestaspaC-snuevasaludforosmedioquienmesespoderchileserC!vecesdecirjosC)estarventagrupohechoellostengoamigocosasnivelgentemismaairesjuliotemashaciafavorjuniolibrepuntobuenoautorabrilbuenatextomarzosaberlistaluegocC3moenerojuegoperC:haberestoynuncamujervalorfueralibrogustaigualvotoscasosguC-apuedosomosavisousteddebennochebuscafaltaeurosseriedichocursoclavecasasleC3nplazolargoobrasvistaapoyojuntotratavistocrearcampohemoscincocargopisosordenhacenC!readiscopedrocercapuedapapelmenorC:tilclarojorgecalleponertardenadiemarcasigueellassiglocochemotosmadreclaserestoniC1oquedapasarbancohijosviajepabloC)stevienereinodejarfondocanalnorteletracausatomarmanoslunesautosvillavendopesartipostengamarcollevapadreunidovamoszonasambosbandamariaabusomuchasubirriojavivirgradochicaallC-jovendichaestantalessalirsuelopesosfinesllamabuscoC)stalleganegroplazahumorpagarjuntadobleislasbolsabaC1ohablaluchaC\u0001readicenjugarnotasvalleallC!cargadolorabajoestC)gustomentemariofirmacostofichaplatahogarartesleyesaquelmuseobasespocosmitadcielochicomiedoganarsantoetapadebesplayaredessietecortecoreadudasdeseoviejodeseaaguas"domaincommonstatuseventsmastersystemactionbannerremovescrollupdateglobalmediumfilternumberchangeresultpublicscreenchoosenormaltravelissuessourcetargetspringmodulemobileswitchphotosborderregionitselfsocialactivecolumnrecordfollowtitle>eitherlengthfamilyfriendlayoutauthorcreatereviewsummerserverplayedplayerexpandpolicyformatdoublepointsseriespersonlivingdesignmonthsforcesuniqueweightpeopleenergynaturesearchfigurehavingcustomoffsetletterwindowsubmitrendergroupsuploadhealthmethodvideosschoolfutureshadowdebatevaluesObjectothersrightsleaguechromesimplenoticesharedendingseasonreportonlinesquarebuttonimagesenablemovinglatestwinterFranceperiodstrongrepeatLondondetailformeddemandsecurepassedtoggleplacesdevicestaticcitiesstreamyellowattackstreetflighthiddeninfo\">openedusefulvalleycausesleadersecretseconddamagesportsexceptratingsignedthingseffectfieldsstatesofficevisualeditorvolumeReportmuseummoviesparentaccessmostlymother\" id=\"marketgroundchancesurveybeforesymbolmomentspeechmotioninsidematterCenterobjectexistsmiddleEuropegrowthlegacymannerenoughcareeransweroriginportalclientselectrandomclosedtopicscomingfatheroptionsimplyraisedescapechosenchurchdefinereasoncorneroutputmemoryiframepolicemodelsNumberduringoffersstyleskilledlistedcalledsilvermargindeletebetterbrowselimitsGlobalsinglewidgetcenterbudgetnowrapcreditclaimsenginesafetychoicespirit-stylespreadmakingneededrussiapleaseextentScriptbrokenallowschargedividefactormember-basedtheoryconfigaroundworkedhelpedChurchimpactshouldalwayslogo\" bottomlist\">){var prefixorangeHeader.push(couplegardenbridgelaunchReviewtakingvisionlittledatingButtonbeautythemesforgotSearchanchoralmostloadedChangereturnstringreloadMobileincomesupplySourceordersviewed courseAbout island<html cookiename=\"amazonmodernadvicein</a>: The dialoghousesBEGIN MexicostartscentreheightaddingIslandassetsEmpireSchooleffortdirectnearlymanualSelect.\n\nOnejoinedmenu\">PhilipawardshandleimportOfficeregardskillsnationSportsdegreeweekly (e.g.behinddoctorloggedunited</b></beginsplantsassistartistissued300px|canadaagencyschemeremainBrazilsamplelogo\">beyond-scaleacceptservedmarineFootercamera</h1>\n_form\"leavesstress\" />\r\n.gif\" onloadloaderOxfordsistersurvivlistenfemaleDesignsize=\"appealtext\">levelsthankshigherforcedanimalanyoneAfricaagreedrecentPeople<br />wonderpricesturned|| {};main\">inlinesundaywrap\">failedcensusminutebeaconquotes150px|estateremoteemail\"linkedright;signalformal1.htmlsignupprincefloat:.png\" forum.AccesspaperssoundsextendHeightsliderUTF-8\"& Before. WithstudioownersmanageprofitjQueryannualparamsboughtfamousgooglelongeri++) {israelsayingdecidehome\">headerensurebranchpiecesblock;statedtop\"><racingresize-->pacitysexualbureau.jpg\" 10,000obtaintitlesamount, Inc.comedymenu\" lyricstoday.indeedcounty_logo.FamilylookedMarketlse ifPlayerturkey);var forestgivingerrorsDomain}else{insertBlog</footerlogin.fasteragents<body 10px 0pragmafridayjuniordollarplacedcoversplugin5,000 page\">boston.test(avatartested_countforumsschemaindex,filledsharesreaderalert(appearSubmitline\">body\">\n* TheThoughseeingjerseyNews</verifyexpertinjurywidth=CookieSTART across_imagethreadnativepocketbox\">\nSystem DavidcancertablesprovedApril reallydriveritem\">more\">boardscolorscampusfirst || [];media.guitarfinishwidth:showedOther .php\" assumelayerswilsonstoresreliefswedenCustomeasily your String\n\nWhiltaylorclear:resortfrenchthough\") + \"<body>buyingbrandsMembername\">oppingsector5px;\">vspacepostermajor coffeemartinmaturehappen</nav>kansaslink\">Images=falsewhile hspace0& \n\nIn powerPolski-colorjordanBottomStart -count2.htmlnews\">01.jpgOnline-rightmillerseniorISBN 00,000 guidesvalue)ectionrepair.xml\" rights.html-blockregExp:hoverwithinvirginphones</tr>\rusing \n\tvar >\');\n\t</td>\n</tr>\nbahasabrasilgalegomagyarpolskisrpskiX1X/Y\bd8-f\u0016\u0007g.\u0000d=\u0013g9\u0001i+\u0014d?!f\u0001/d8-e\u001b=f\b\u0011d;,d8\u0000d8*e\u0005,e\u000f8g.!g\u0010\u0006h.:e\u001d\u001be\u000f/d;%f\u001c\re\n!f\u00176i\u00174d8*d::d:\'e\u0013\u0001h\u0007*e71d<\u0001d8\u001af\u001f%g\u001c\u000be7%d=\u001ch\u0001\u0014g3;f2!f\u001c\tg=\u0011g+\u0019f\t\u0000f\u001c\th/\u0004h.:d8-e?\u0003f\u0016\u0007g+ g\u0014(f\b7i&\u0016i!5d=\u001ch\u0000\u0005f\n\u0000f\u001c/i\u0017.i\"\u0018g\u001b8e\u00053d8\u000bh==f\u0010\u001cg4\"d=?g\u0014(h=/d;6e\u001c(g:?d8;i\"\u0018h5\u0004f\u0016\u0019h\'\u0006i\"\u0011e\u001b\u001ee$\rf3(e\u0006\fg=\u0011g;\u001cf\u00146h\u0017\u000fe\u0006\u0005e.9f\u000e(h\r\u0010e8\u0002e\u001c:f6\bf\u0001/g):i\u00174e\u000f\u0011e8\u0003d;\u0000d9\be%=e\u000f\u000bg\u0014\u001ff4;e\u001b>g\t\u0007e\u000f\u0011e1\u0015e&\u0002f\u001e\u001cf\t\u000bf\u001c:f\u00160i\u0017;f\u001c\u0000f\u00160f\u00169e<\u000fe\f\u0017d:,f\u000f\u0010d>\u001be\u00053d:\u000ef\u001b4e$\u001ah?\u0019d8*g3;g;\u001fg\u001f%i\u0001\u0013f88f\b\u000fe9?e\u0011\ne\u00056d;\u0016e\u000f\u0011h!(e.\te\u0005(g,,d8\u0000d<\u001ae\u0011\u0018h?\u001bh!\fg\u00029e\u0007;g\t\bf\u001d\u0003g\u00145e-\u0010d8\u0016g\u0015\fh.>h.!e\u0005\rh49f\u0015\u0019h\u00022e\n e\u0005%f4;e\n(d;\u0016d;,e\u0015\u0006e\u0013\u0001e\r\u001ae.\"g\u000e0e\u001c(d8\nf57e&\u0002d=\u0015e72g;\u000fg\u0015\u0019h(\u0000h/&g;\u0006g$>e\f:g\u0019;e=\u0015f\u001c,g+\u0019i\u001c\u0000h&\u0001d;7f <f\u0014/f\f\u0001e\u001b=i\u0019\u0005i\u0013>f\u000e%e\u001b=e.6e;:h.>f\u001c\u000be\u000f\u000bi\u0018\u0005h/;f3\u0015e>\u000bd=\rg=.g;\u000ff5\u000ei\u0000\tf\u000b)h?\u0019f 7e=\u0013e\t\re\b\u0006g1;f\u000e\u0012h!\fe\u001b d8:d:$f\u0018\u0013f\u001c\u0000e\u0010\u000ei\u001f3d9\u0010d8\rh\u0003=i\u0000\u001ah?\u0007h!\fd8\u001ag\'\u0011f\n\u0000e\u000f/h\u0003=h.>e$\u0007e\u0010\bd=\u001ce$\'e.6g$>d<\u001ag \u0014g)6d8\u0013d8\u001ae\u0005(i\u0003(i!9g\u001b.h?\u0019i\u0007\fh?\u0018f\u0018/e<\u0000e\'\u000bf\u0003\u0005e\u00065g\u00145h\u0004\u0011f\u0016\u0007d;6e\u0013\u0001g\t\fe8.e\n)f\u0016\u0007e\f\u0016h5\u0004f:\u0010e$\'e-&e-&d9 e\u001c0e\u001d\u0000f5\u000fh\'\bf\n\u0015h5\u0004e7%g(\u000bh&\u0001f1\u0002f\u0000\u000ed9\bf\u00176e\u0000\u0019e\n\u001fh\u0003=d8;h&\u0001g\u001b.e\t\rh5\u0004h./e\u001f\u000ee8\u0002f\u00169f3\u0015g\u00145e=1f\u000b\u001bh\u0001\u0018e#0f\u0018\u000ed;;d=\u0015e\u0001%e:7f\u00150f\r.g>\u000ee\u001b=f1=h=&d;\u000bg;\rd=\u0006f\u0018/d:$f5\u0001g\u0014\u001fd:\'f\t\u0000d;%g\u00145h/\u001df\u0018>g$:d8\u0000d:\u001be\r\u0015d=\rd::e\u0011\u0018e\b\u0006f\u001e\u0010e\u001c0e\u001b>f\u0017\u0005f88e7%e\u00057e-&g\u0014\u001fg3;e\b\u0017g=\u0011e\u000f\u000be8\u0016e-\u0010e/\u0006g \u0001i\"\u0011i\u0001\u0013f\u000e\'e\b6e\u001c0e\f:e\u001f:f\u001c,e\u0005(e\u001b=g=\u0011d8\ni\u0007\rh&\u0001g,,d:\fe\u0016\u001cf,\"h?\u001be\u0005%e\u000f\u000bf\u0003\u0005h?\u0019d:\u001bh\u0000\u0003h/\u0015e\u000f\u0011g\u000e0e\u001f9h.-d;%d8\nf\u0014?e:\u001cf\b\u0010d8:g\u000e/e\"\u0003i&\u0019f8/e\u0010\ff\u00176e(1d9\u0010e\u000f\u0011i\u0000\u0001d8\u0000e.\u001ae<\u0000e\u000f\u0011d=\u001ce\u0013\u0001f \u0007e\u0007\u0006f,\"h?\u000eh\'#e\u00063e\u001c0f\u00169d8\u0000d8\u000bd;%e\u000f\nh4#d;;f\b\u0016h\u0000\u0005e.\"f\b7d;#h!(g\'/e\b\u0006e%3d::f\u00150g \u0001i\u0014\u0000e\u0014.e\u0007:g\u000e0g&;g:?e:\u0014g\u0014(e\b\u0017h!(d8\re\u0010\fg<\u0016h>\u0011g;\u001fh.!f\u001f%h/\"d8\rh&\u0001f\u001c\te\u00053f\u001c:f\u001e\u0004e>\be$\u001af\u0012-f\u0014>g;\u0004g;\u0007f\u0014?g-\u0016g\u001b4f\u000e%h\u0003=e\n\u001bf\u001d%f:\u0010f\u0019\u0002i\u0016\u0013g\u001c\u000be\b0g\u0003-i\u0017(e\u00053i\u0014.d8\u0013e\f:i\u001d\u001ee88h\u000b1h/-g\u0019>e:&e8\ff\u001c\u001bg>\u000ee%3f/\u0014h>\u0003g\u001f%h/\u0006h\'\u0004e.\u001ae;:h..i\u0003(i\u0017(f\u0004\u000fh\'\u0001g2>e=)f\u0017%f\u001c,f\u000f\u0010i+\u0018e\u000f\u0011h(\u0000f\u00169i\u001d\"e\u001f:i\u0007\u0011e$\u0004g\u0010\u0006f\u001d\u0003i\u0019\u0010e=1g\t\u0007i\u00136h!\fh?\u0018f\u001c\te\b\u0006d:+g\t)e\u0013\u0001g;\u000fh\u0010%f7;e\n d8\u0013e.6h?\u0019g\'\rh/\u001di\"\u0018h57f\u001d%d8\u001ae\n!e\u0005,e\u0011\nh.0e=\u0015g.\u0000d;\u000bh4(i\u0007\u000fg\u00147d::e=1e\u0013\re<\u0015g\u0014(f\n%e\u0011\ni\u0003(e\b\u0006e?+i\u0000\u001fe\u0012(h/\"f\u00176e0\u001af3(f\u0004\u000fg\u00143h/7e-&f !e:\u0014h/%e\u000e\u0006e\u000f2e\u000f*f\u0018/h?\u0014e\u001b\u001eh4-d90e\u0010\rg\'0d8:d:\u0006f\b\u0010e\n\u001fh/4f\u0018\u000ed>\u001be:\u0014e-)e-\u0010d8\u0013i\"\u0018g(\u000be:\u000fd8\u0000h\b,f\u001c\u0003e\u0013!e\u000f*f\u001c\te\u00056e.\u0003d?\u001df\n$h\u0000\fd8\u0014d;\ne$)g*\u0017e\u000f#e\n(f\u0000\u0001g\n6f\u0000\u0001g\t9e\b+h.$d8:e?\u0005i!;f\u001b4f\u00160e0\u000fh/4f\b\u0011e\u0000\u0011d=\u001cd8:e*\u0012d=\u0013e\f\u0005f\u000b,i\u0002#d9\bd8\u0000f 7e\u001b=e\u0006\u0005f\u0018/e\u0010&f 9f\r.g\u00145h\'\u0006e-&i\u0019\"e\u00057f\u001c\th?\u0007g(\u000bg\u00141d:\u000ed::f\t\re\u0007:f\u001d%d8\rh?\u0007f-#e\u001c(f\u0018\u000ef\u0018\u001ff\u0015\u0005d:\u000be\u00053g3;f \u0007i\"\u0018e\u0015\u0006e\n!h>\u0013e\u0005%d8\u0000g\u001b4e\u001f:g!\u0000f\u0015\u0019e-&d:\u0006h\'#e;:g-\u0011g;\u0013f\u001e\u001ce\u0005(g\u0010\u0003i\u0000\u001ag\u001f%h.!e\b\u0012e/9d:\u000eh\t:f\u001c/g\u001b8e\u0006\fe\u000f\u0011g\u0014\u001fg\u001c\u001fg\u001a\u0004e;:g+\u000bg-\tg:\'g1;e\u001e\u000bg;\u000fi*\fe.\u001eg\u000e0e\b6d=\u001cf\u001d%h\u0007*f \u0007g->d;%d8\u000be\u000e\u001fe\b\u001bf\u0017 f3\u0015e\u00056d8-e\u0000\u000bd::d8\u0000e\b\u0007f\f\u0007e\r\u0017e\u00053i\u0017-i\u001b\u0006e\u001b\"g,,d8\te\u00053f3(e\u001b f-$g\u0005\'g\t\u0007f71e\u001c3e\u0015\u0006d8\u001ae9?e7\u001ef\u0017%f\u001c\u001fi+\u0018g:\'f\u001c\u0000h?\u0011g;<e\u0010\bh!(g$:d8\u0013h>\u0011h!\fd8:d:$i\u0000\u001ah/\u0004d;7h\'\te>\u0017g2>e\r\u000ee.6e:-e.\ff\b\u0010f\u0004\u001fh\'\te.\th#\u0005e>\u0017e\b0i\u0002.d;6e\b6e:&i#\u001fe\u0013\u0001h\u0019=g\u00046h=,h==f\n%d;7h.0h\u0000\u0005f\u00169f!\bh!\ff\u0014?d::f0\u0011g\u0014(e\u0013\u0001d8\u001ch%?f\u000f\u0010e\u0007:i\u0005\u0012e:\u0017g\u00046e\u0010\u000ed;\u0018f,>g\u0003-g\u00029d;%e\t\re.\fe\u0005(e\u000f\u0011e8\u0016h.>g=.i\"\u0006e/<e7%d8\u001ae\f;i\u0019\"g\u001c\u000bg\u001c\u000bg;\u000fe\u00058e\u000e\u001fe\u001b e93e\u000f0e\u0010\u0004g\'\re\"\u001ee\n f\u001d\u0010f\u0016\u0019f\u00160e\"\u001ed9\u000be\u0010\u000eh\u0001\fd8\u001af\u0015\bf\u001e\u001cd;\ne94h.:f\u0016\u0007f\b\u0011e\u001b=e\u0011\nh/\tg\t\bd8;d?.f\u00149e\u000f\u0002d8\u000ef\t\u0013e\r0e?+d9\u0010f\u001c:f\"0h\'\u0002g\u00029e-\u0018e\u001c(g2>g%\u001eh\u000e7e>\u0017e\b)g\u0014(g;\'g;-d= d;,h?\u0019d9\bf(!e<\u000fh/-h(\u0000h\u0003=e$\u001fi\u001b\u0005h\u0019\u000ef\u0013\rd=\u001ci#\u000ef <d8\u0000h57g\'\u0011e-&d=\u0013h\u00022g\u001f-d?!f\u001d!d;6f2;g\u0016\u0017h?\u0010e\n(d:\'d8\u001ad<\u001ah..e/<h\b*e\u0005\bg\u0014\u001fh\u0001\u0014g\u001b\u001fe\u000f/f\u0018/e\u0015\u000fi!\fg;\u0013f\u001e\u0004d=\u001cg\u0014(h0\u0003f\u001f%h3\u0007f\u0016\u0019h\u0007*e\n(h4\u001fh4#e\u0006\u001cd8\u001ah.?i\u0017.e.\u001ef\u0016=f\u000e%e\u000f\u0017h.(h.:i\u0002#d8*e\u000f\ri&\be\n e<:e%3f\u0000\'h\f\u0003e\u001b4f\u001c\re\u000b\u0019d<\u0011i\u00172d;\nf\u0017%e.\"f\u001c\rh\'\u0000g\u001c\u000be\u000f\u0002e\n g\u001a\u0004h/\u001dd8\u0000g\u00029d?\u001dh/\u0001e\u001b>d9&f\u001c\tf\u0015\bf5\u000bh/\u0015g\';e\n(f\t\rh\u0003=e\u00063e.\u001ah\u0002!g%(d8\rf\u0016-i\u001c\u0000f1\u0002d8\re>\u0017e\n\u001ef3\u0015d9\u000bi\u00174i\u0007\u0007g\u0014(h\u0010%i\u0014\u0000f\n\u0015h/\tg\u001b.f \u0007g\b1f\u0003\u0005f\u0011\u0004e=1f\u001c\td:\u001bh$\u0007h#=f\u0016\u0007e-&f\u001c:d<\u001af\u00150e-\u0017h#\u0005d?.h4-g\t)e\u0006\u001cf\u001d\u0011e\u0005(i\u001d\"g2>e\u0013\u0001e\u00056e.\u001ed:\u000bf\u0003\u0005f04e93f\u000f\u0010g$:d8\ne8\u0002h0\"h0\"f\u0019.i\u0000\u001af\u0015\u0019e8\bd8\nd< g1;e\b+f-\ff\u001b2f\u000b%f\u001c\te\b\u001bf\u00160i\u0005\rd;6e\u000f*h&\u0001f\u00176d;#h3\u0007h(\nh>>e\b0d::g\u0014\u001fh.\"i\u0018\u0005h\u0000\u0001e8\be1\u0015g$:e?\u0003g\u0010\u0006h44e-\u0010g62g+\u0019d8;i!\fh\u0007*g\u00046g:\'e\b+g.\u0000e\r\u0015f\u00149i\u001d)i\u0002#d:\u001bf\u001d%h/4f\t\u0013e<\u0000d;#g \u0001e\b i\u0019$h/\u0001e\b8h\n\u0002g\u001b.i\u0007\rg\u00029f,!f\u00158e$\u001ae0\u0011h\'\u0004e\b\u0012h5\u0004i\u0007\u0011f\t>e\b0d;%e\u0010\u000ee$\'e\u0005(d8;i!5f\u001c\u0000d=3e\u001b\u001eg-\u0014e$)d8\u000bd?\u001di\u001a\u001cg\u000e0d;#f#\u0000f\u001f%f\n\u0015g%(e0\u000ff\u00176f2\u0012f\u001c\tf-#e88g\u0014\u001ah\u00073d;#g\u0010\u0006g\u001b.e=\u0015e\u0005,e<\u0000e$\re\b6i\u0007\u0011h\u001e\re98g&\u000fg\t\bf\u001c,e=\"f\b\u0010e\u0007\u0006e$\u0007h!\ff\u0003\u0005e\u001b\u001ee\b0f\u0000\u001df\u00033f\u0000\u000ef 7e\r\u000fh..h.$h/\u0001f\u001c\u0000e%=d:\'g\u0014\u001ff\f\tg\u0005\'f\u001c\rh#\u0005e9?d8\u001ce\n(f<+i\u0007\u0007h4-f\u00160f\t\u000bg;\u0004e\u001b>i\u001d\"f\u001d?e\u000f\u0002h\u0000\u0003f\u0014?f2;e.9f\u0018\u0013e$)e\u001c0e\n*e\n\u001bd::d;,e\r\u0007g:\'i\u0000\u001fe:&d::g\t)h0\u0003f\u00154f5\u0001h!\fi\u0000 f\b\u0010f\u0016\u0007e-\u0017i\u001f)e\u001b=h48f\u0018\u0013e<\u0000e1\u0015g\u001b8i\u0017\u001ch!(g\u000e0e=1h\'\u0006e&\u0002f-$g>\u000ee.9e$\'e0\u000ff\n%i\u0001\u0013f\u001d!f,>e?\u0003f\u0003\u0005h.8e$\u001af3\u0015h\'\u0004e.6e1\u0005d9&e:\u0017h?\u001ef\u000e%g+\u000be\r3d8>f\n%f\n\u0000e7\'e%%h?\u0010g\u0019;e\u0005%d;%f\u001d%g\u0010\u0006h.:d:\u000bd;6h\u0007*g\u00141d8-e\r\u000ee\n\u001ee\u0005,e&\be&\bg\u001c\u001ff-#d8\ri\u0014\u0019e\u0005(f\u0016\u0007e\u0010\be\u0010\fd;7e\u0000<e\b+d::g\u001b\u0011g\u001d#e\u00057d=\u0013d8\u0016g:*e\u001b\"i\u0018\u001fe\b\u001bd8\u001af\t?f\u000b\u0005e\"\u001ei\u0015?f\u001c\td::d?\u001df\f\u0001e\u0015\u0006e.6g;4d?.e\u000f0f9>e7&e\u000f3h\u0002!d;=g-\u0014f!\be.\u001ei\u0019\u0005g\u00145d?!g;\u000fg\u0010\u0006g\u0014\u001fe\u0011=e.#d< d;;e\n!f-#e<\u000fg\t9h\t2d8\u000bf\u001d%e\r\u000fd<\u001ae\u000f*h\u0003=e=\u0013g\u00046i\u0007\rf\u00160e\u0005\'e.9f\f\u0007e/<h?\u0010h!\ff\u0017%e?\u0017h3#e.6h6\u0005h?\u0007e\u001c\u001fe\u001c0f5\u0019f1\u001ff\u0014/d;\u0018f\u000e(e\u0007:g+\u0019i\u0015?f\u001d-e7\u001ef\t\'h!\fe\b6i\u0000 d9\u000bd8\u0000f\u000e(e9?g\u000e0e\u001c:f\u000f\u000fh?0e\u000f\u0018e\f\u0016d< g;\u001ff-\ff\t\u000bd?\u001di\u0019)h/>g(\u000be\f;g\u0016\u0017g;\u000fh?\u0007h?\u0007e\u000e;d9\u000be\t\rf\u00146e\u0005%e94e:&f\u001d\u0002e?\u0017g>\u000ed8=f\u001c\u0000i+\u0018g\u0019;i\u0019\u0006f\u001c*f\u001d%e\n e7%e\u0005\rh4#f\u0015\u0019g(\u000bg\t\be\u001d\u0017h:+d=\u0013i\u0007\re:\u0006e\u0007:e\u0014.f\b\u0010f\u001c,e=\"e<\u000fe\u001c\u001fh1\u0006e\u0007:e\u00039d8\u001cf\u00169i\u0002.g.1e\r\u0017d:,f1\u0002h\u0001\fe\u000f\u0016e>\u0017h\u0001\fd=\rg\u001b8d?!i!5i\u001d\"e\b\u0006i\u0012\u001fg=\u0011i!5g!.e.\u001ae\u001b>d>\u000bg=\u0011e\u001d\u0000g\'/f\u001e\u0001i\u0014\u0019h//g\u001b.g\u001a\u0004e.\u001dh4\u001df\u001c:e\u00053i#\u000ei\u0019)f\u000e\bf\u001d\u0003g\u0017\u0005f/\u0012e. g\t)i\u0019$d:\u0006h)\u0015h+\u0016g\u0016>g\u0017\u0005e\u000f\nf\u00176f1\u0002h4-g+\u0019g\u00029e\u0004?g+%f/\u000fe$)d8-e$.h.$h/\u0006f/\u000fd8*e$)f4%e-\u0017d=\u0013e\u000f0g\u0001#g;4f\n$f\u001c,i!5d8*f\u0000\'e.\u0018f\u00169e88h\'\u0001g\u001b8f\u001c:f\b\u0018g\u0015%e:\u0014e=\u0013e>\u000be8\bf\u00169d>?f !e\u001b-h\u0002!e8\u0002f\b?e1\u000bf \u000fg\u001b.e\u0011\u0018e7%e/<h\u00074g*\u0001g\u00046i\u0001\u0013e\u00057f\u001c,g=\u0011g;\u0013e\u0010\bf!#f!\be\n3e\n(e\u000f&e$\u0016g>\u000ee\u0005\u0003e<\u0015h57f\u00149e\u000f\u0018g,,e\u001b\u001bd<\u001ah.!h**f\u0018\u000ei\u001a\u0010g\'\u0001e.\u001de.\u001dh\'\u0004h\f\u0003f6\bh49e\u00051e\u0010\fe?\u0018h.0d=\u0013g3;e8&f\u001d%e\u0010\re-\u0017g\u0019<h!(e<\u0000f\u0014>e\n g\u001b\u001fe\u000f\u0017e\b0d:\ff\t\u000be$\'i\u0007\u000ff\b\u0010d::f\u00150i\u0007\u000fe\u00051d:+e\f:e\u001f\u001fe%3e-)e\u000e\u001fe\b\u0019f\t\u0000e\u001c(g;\u0013f\u001d\u001fi\u0000\u001ad?!h6\u0005g:\'i\u0005\rg=.e=\u0013f\u00176d<\u0018g\'\u0000f\u0000\'f\u0004\u001ff\b?d:\'i\u0001\nf\b2e\u0007:e\u000f#f\u000f\u0010d:$e01d8\u001ad?\u001de\u0001%g(\u000be:&e\u000f\u0002f\u00150d:\u000bd8\u001af\u00154d8*e11d8\u001cf\u0003\u0005f\u0004\u001fg\t9f.\ne\b\u0006i!\u001ef\u0010\u001ce0\u000be1\u001ed:\u000ei\u0017(f\b7h4\"e\n!e#0i\u001f3e\u000f\ne\u00056h4\"g;\u000fe\u001d\u001af\f\u0001e92i\u0003(f\b\u0010g+\u000be\b)g\u001b\nh\u0000\u0003h\u0019\u0011f\b\u0010i\u0003=e\f\u0005h#\u0005g\u0014(f\b6f/\u0014h5\u001bf\u0016\u0007f\u0018\u000ef\u000b\u001be\u0015\u0006e.\ff\u00154g\u001c\u001ff\u0018/g\u001c<g\u001d\u001bd<\u0019d<4e(\u0001f\u001c\u001bi\"\u0006e\u001f\u001fe\r+g\u0014\u001fd<\u0018f\u0003 h+\u0016e#\u0007e\u0005,e\u00051h\t/e%=e\u0005\u0005e\b\u0006g,&e\u0010\bi\u0019\u0004d;6g\t9g\u00029d8\re\u000f/h\u000b1f\u0016\u0007h5\u0004d:\'f 9f\u001c,f\u0018\u000ef\u0018>e/\u0006g\"<e\u0005,d<\u0017f0\u0011f\u0017\u000ff\u001b4e\n d:+e\u000f\u0017e\u0010\fe-&e\u0010/e\n(i\u0000\u0002e\u0010\be\u000e\u001ff\u001d%i\u0017.g-\u0014f\u001c,f\u0016\u0007g>\u000ei#\u001fg;?h\t2g(3e.\u001ag;\bd:\u000eg\u0014\u001fg\t)d>\u001bf1\u0002f\u0010\u001cg\u000b\u0010e\n\u001bi\u0007\u000fd8%i\u0007\rf08h?\u001ce\u0006\u0019g\u001c\u001ff\u001c\ti\u0019\u0010g+\u001ed:\te/9h1!h49g\u0014(d8\re%=g;\u001de/9e\r\u0001e\b\u0006d?\u0003h?\u001bg\u00029h/\u0004e=1i\u001f3d<\u0018e\n?d8\re0\u0011f,#h5\u000fe96d8\u0014f\u001c\tg\u00029f\u00169e\u0010\u0011e\u0005(f\u00160d?!g\u0014(h.>f\u0016=e=\"h1!h5\u0004f <g*\u0001g 4i\u001a\u000fg\u001d\u0000i\u0007\re$\'d:\u000ef\u0018/f/\u0015d8\u001af\u0019:h\u0003=e\f\u0016e7%e.\fg>\u000ee\u0015\u0006e\u001f\u000eg;\u001fd8\u0000e\u0007:g\t\bf\t\u0013i\u0000 g\u0014\"e\u0013\u0001f&\u0002e\u00065g\u0014(d:\u000ed?\u001dg\u0015\u0019e\u001b g4 d8-e\u001c\u000be-\u0018e\u0002(h44e\u001b>f\u001c\u0000f\u0004\u001bi\u0015?f\u001c\u001fe\u000f#d;7g\u0010\u0006h4\"e\u001f:e\u001c0e.\tf\u000e\u0012f-&f1\ti\u0007\fi\u001d\"e\b\u001be;:e$)g):i&\u0016e\u0005\be.\fe\u0016\u0004i)1e\n(d8\u000bi\u001d\"d8\re\u0006\rh/\u001ad?!f\u0004\u000fd9\ti\u00183e\u0005\th\u000b1e\u001b=f<\u0002d:.e\u0006\u001bd:\u000bg\u000e)e.6g>$d<\u0017e\u0006\u001cf0\u0011e\r3e\u000f/e\u0010\rg(1e.6e\u00057e\n(g\u0014;f\u00033e\b0f3(f\u0018\u000ee0\u000fe-&f\u0000\'h\u0003=h\u0000\u0003g \u0014g!,d;6h\'\u0002g\u001c\u000bf8\u0005f%\u001af\u0010\u001eg,\u0011i&\u0016i \u0001i;\u0004i\u0007\u0011i\u0000\u0002g\u0014(f1\u001fh\u000b\u000fg\u001c\u001fe.\u001ed8;g.!i\u00186f.5h(;e\u0006\ng?;h/\u0011f\u001d\u0003e\b)e\u0001\u001ae%=d<<d9\u000ei\u0000\u001ah./f\u0016=e7%g\u000b\u0000f\u0005\u000bd9\u001fh.8g\u000e/d?\u001de\u001f9e\u0005;f&\u0002e?5e$\'e\u001e\u000bf\u001c:g%(g\u0010\u0006h\'#e\f?e\u0010\rcuandoenviarmadridbuscariniciotiempoporquecuentaestadopuedenjuegoscontraestC!nnombretienenperfilmaneraamigosciudadcentroaunquepuedesdentroprimerpreciosegC:nbuenosvolverpuntossemanahabC-aagostonuevosunidoscarlosequiponiC1osmuchosalgunacorreoimagenpartirarribamarC-ahombreempleoverdadcambiomuchasfueronpasadolC-neaparecenuevascursosestabaquierolibroscuantoaccesomiguelvarioscuatrotienesgruposserC!neuropamediosfrenteacercademC!sofertacochesmodeloitalialetrasalgC:ncompracualesexistecuerposiendoprensallegarviajesdineromurciapodrC!puestodiariopuebloquieremanuelpropiocrisisciertoseguromuertefuentecerrargrandeefectopartesmedidapropiaofrecetierrae-mailvariasformasfuturoobjetoseguirriesgonormasmismosC:nicocaminositiosrazC3ndebidopruebatoledotenC-ajesC:sesperococinaorigentiendacientocC!dizhablarserC-alatinafuerzaestiloguerraentrarC)xitolC3pezagendavC-deoevitarpaginametrosjavierpadresfC!cilcabezaC!reassalidaenvC-ojapC3nabusosbienestextosllevarpuedanfuertecomC:nclaseshumanotenidobilbaounidadestC!seditarcreadoP4P;Q\u000fQ\u0007Q\u0002P>P:P0P:P8P;P8Q\rQ\u0002P>P2Q\u0001P5P5P3P>P?Q\u0000P8Q\u0002P0P:P5Q\tP5Q\u0003P6P5P\u001aP0P:P1P5P7P1Q\u000bP;P>P=P8P\u0012Q\u0001P5P?P>P4P-Q\u0002P>Q\u0002P>P<Q\u0007P5P<P=P5Q\u0002P;P5Q\u0002Q\u0000P0P7P>P=P0P3P4P5P<P=P5P\u0014P;Q\u000fP\u001fQ\u0000P8P=P0Q\u0001P=P8Q\u0005Q\u0002P5P<P:Q\u0002P>P3P>P4P2P>Q\u0002Q\u0002P0P<P!P(P\u0010P<P0Q\u000fP\'Q\u0002P>P2P0Q\u0001P2P0P<P5P<Q\u0003P\"P0P:P4P2P0P=P0P<Q\rQ\u0002P8Q\rQ\u0002Q\u0003P\u0012P0P<Q\u0002P5Q\u0005P?Q\u0000P>Q\u0002Q\u0003Q\u0002P=P0P4P4P=Q\u000fP\u0012P>Q\u0002Q\u0002Q\u0000P8P=P5P9P\u0012P0Q\u0001P=P8P<Q\u0001P0P<Q\u0002P>Q\u0002Q\u0000Q\u0003P1P\u001eP=P8P<P8Q\u0000P=P5P5P\u001eP\u001eP\u001eP;P8Q\u0006Q\rQ\u0002P0P\u001eP=P0P=P5P<P4P>P<P<P>P9P4P2P5P>P=P>Q\u0001Q\u0003P4`$\u0015`%\u0007`$9`%\b`$\u0015`%\u0000`$8`%\u0007`$\u0015`$>`$\u0015`%\u000b`$\u0014`$0`$*`$0`$(`%\u0007`$\u000f`$\u0015`$\u0015`$?`$-`%\u0000`$\u0007`$8`$\u0015`$0`$$`%\u000b`$9`%\u000b`$\u0006`$*`$9`%\u0000`$/`$9`$/`$>`$$`$\u0015`$%`$>jagran`$\u0006`$\u001c`$\u001c`%\u000b`$\u0005`$,`$&`%\u000b`$\u0017`$\b`$\u001c`$>`$\u0017`$\u000f`$9`$.`$\u0007`$(`$5`$9`$/`%\u0007`$%`%\u0007`$%`%\u0000`$\u0018`$0`$\u001c`$,`$&`%\u0000`$\u0015`$\b`$\u001c`%\u0000`$5`%\u0007`$(`$\b`$(`$\u000f`$9`$0`$\t`$8`$.`%\u0007`$\u0015`$.`$5`%\u000b`$2`%\u0007`$8`$,`$.`$\b`$&`%\u0007`$\u0013`$0`$\u0006`$.`$,`$8`$-`$0`$,`$(`$\u001a`$2`$.`$(`$\u0006`$\u0017`$8`%\u0000`$2`%\u0000X9Y\u0004Y\tX%Y\u0004Y\tY\u0007X0X\'X\"X.X1X9X/X/X\'Y\u0004Y\tY\u0007X0Y\u0007X5Y\bX1X:Y\nX1Y\u0003X\'Y\u0006Y\bY\u0004X\'X(Y\nY\u0006X9X1X6X0Y\u0004Y\u0003Y\u0007Y\u0006X\'Y\nY\bY\u0005Y\u0002X\'Y\u0004X9Y\u0004Y\nX\'Y\u0006X\'Y\u0004Y\u0003Y\u0006X-X*Y\tY\u0002X(Y\u0004Y\bX-X)X\'X.X1Y\u0001Y\u0002X7X9X(X/X1Y\u0003Y\u0006X%X0X\'Y\u0003Y\u0005X\'X\'X-X/X%Y\u0004X\'Y\u0001Y\nY\u0007X(X9X6Y\u0003Y\nY\u0001X(X-X+Y\bY\u0005Y\u0006Y\bY\u0007Y\bX#Y\u0006X\'X,X/X\'Y\u0004Y\u0007X\'X3Y\u0004Y\u0005X9Y\u0006X/Y\u0004Y\nX3X9X(X1X5Y\u0004Y\tY\u0005Y\u0006X0X(Y\u0007X\'X#Y\u0006Y\u0007Y\u0005X+Y\u0004Y\u0003Y\u0006X*X\'Y\u0004X\'X-Y\nX+Y\u0005X5X1X4X1X-X-Y\bY\u0004Y\bY\u0001Y\nX\'X0X\'Y\u0004Y\u0003Y\u0004Y\u0005X1X)X\'Y\u0006X*X\'Y\u0004Y\u0001X#X(Y\bX.X\'X5X#Y\u0006X*X\'Y\u0006Y\u0007X\'Y\u0004Y\nX9X6Y\bY\bY\u0002X/X\'X(Y\u0006X.Y\nX1X(Y\u0006X*Y\u0004Y\u0003Y\u0005X4X\'X!Y\bY\u0007Y\nX\'X(Y\bY\u0002X5X5Y\bY\u0005X\'X1Y\u0002Y\u0005X#X-X/Y\u0006X-Y\u0006X9X/Y\u0005X1X#Y\nX\'X-X)Y\u0003X*X(X/Y\bY\u0006Y\nX,X(Y\u0005Y\u0006Y\u0007X*X-X*X,Y\u0007X)X3Y\u0006X)Y\nX*Y\u0005Y\u0003X1X)X:X2X)Y\u0006Y\u0001X3X(Y\nX*Y\u0004Y\u0004Y\u0007Y\u0004Y\u0006X\'X*Y\u0004Y\u0003Y\u0002Y\u0004X(Y\u0004Y\u0005X\'X9Y\u0006Y\u0007X#Y\bY\u0004X4Y\nX!Y\u0006Y\bX1X#Y\u0005X\'Y\u0001Y\nY\u0003X(Y\u0003Y\u0004X0X\'X*X1X*X(X(X#Y\u0006Y\u0007Y\u0005X3X\'Y\u0006Y\u0003X(Y\nX9Y\u0001Y\u0002X/X-X3Y\u0006Y\u0004Y\u0007Y\u0005X4X9X1X#Y\u0007Y\u0004X4Y\u0007X1Y\u0002X7X1X7Y\u0004X(profileservicedefaulthimselfdetailscontentsupportstartedmessagesuccessfashion<title>countryaccountcreatedstoriesresultsrunningprocesswritingobjectsvisiblewelcomearticleunknownnetworkcompanydynamicbrowserprivacyproblemServicerespectdisplayrequestreservewebsitehistoryfriendsoptionsworkingversionmillionchannelwindow.addressvisitedweathercorrectproductedirectforwardyou canremovedsubjectcontrolarchivecurrentreadinglibrarylimitedmanagerfurthersummarymachineminutesprivatecontextprogramsocietynumberswrittenenabledtriggersourcesloadingelementpartnerfinallyperfectmeaningsystemskeepingculture",journalprojectsurfaces"expiresreviewsbalanceEnglishContentthroughPlease opinioncontactaverageprimaryvillageSpanishgallerydeclinemeetingmissionpopularqualitymeasuregeneralspeciessessionsectionwriterscounterinitialreportsfiguresmembersholdingdisputeearlierexpressdigitalpictureAnothermarriedtrafficleadingchangedcentralvictoryimages/reasonsstudiesfeaturelistingmust beschoolsVersionusuallyepisodeplayinggrowingobviousoverlaypresentactions</ul>\r\nwrapperalreadycertainrealitystorageanotherdesktopofferedpatternunusualDigitalcapitalWebsitefailureconnectreducedAndroiddecadesregular & animalsreleaseAutomatgettingmethodsnothingPopularcaptionletterscapturesciencelicensechangesEngland=1&History = new CentralupdatedSpecialNetworkrequirecommentwarningCollegetoolbarremainsbecauseelectedDeutschfinanceworkersquicklybetweenexactlysettingdiseaseSocietyweaponsexhibit<!--Controlclassescoveredoutlineattacksdevices(windowpurposetitle=\"Mobile killingshowingItaliandroppedheavilyeffects-1\']);\nconfirmCurrentadvancesharingopeningdrawingbillionorderedGermanyrelated</form>includewhetherdefinedSciencecatalogArticlebuttonslargestuniformjourneysidebarChicagoholidayGeneralpassage,"animatefeelingarrivedpassingnaturalroughly.\n\nThe but notdensityBritainChineselack oftributeIreland\" data-factorsreceivethat isLibraryhusbandin factaffairsCharlesradicalbroughtfindinglanding:lang=\"return leadersplannedpremiumpackageAmericaEdition]"Messageneed tovalue=\"complexlookingstationbelievesmaller-mobilerecordswant tokind ofFirefoxyou aresimilarstudiedmaximumheadingrapidlyclimatekingdomemergedamountsfoundedpioneerformuladynastyhow to SupportrevenueeconomyResultsbrothersoldierlargelycalling."AccountEdward segmentRobert effortsPacificlearnedup withheight:we haveAngelesnations_searchappliedacquiremassivegranted: falsetreatedbiggestbenefitdrivingStudiesminimumperhapsmorningsellingis usedreversevariant role=\"missingachievepromotestudentsomeoneextremerestorebottom:evolvedall thesitemapenglishway to AugustsymbolsCompanymattersmusicalagainstserving})();\r\npaymenttroubleconceptcompareparentsplayersregionsmonitor \'\'The winningexploreadaptedGalleryproduceabilityenhancecareers). The collectSearch ancientexistedfooter handlerprintedconsoleEasternexportswindowsChannelillegalneutralsuggest_headersigning.html\">settledwesterncausing-webkitclaimedJusticechaptervictimsThomas mozillapromisepartieseditionoutside:false,hundredOlympic_buttonauthorsreachedchronicdemandssecondsprotectadoptedprepareneithergreatlygreateroverallimprovecommandspecialsearch.worshipfundingthoughthighestinsteadutilityquarterCulturetestingclearlyexposedBrowserliberal} catchProjectexamplehide();FloridaanswersallowedEmperordefenseseriousfreedomSeveral-buttonFurtherout of != nulltrainedDenmarkvoid(0)/all.jspreventRequestStephen\n\nWhen observe</h2>\r\nModern provide\" alt=\"borders.\n\nFor \n\nMany artistspoweredperformfictiontype ofmedicalticketsopposedCouncilwitnessjusticeGeorge Belgium...</a>twitternotablywaitingwarfare Other rankingphrasesmentionsurvivescholar</p>\r\n Countryignoredloss ofjust asGeorgiastrange<head><stopped1\']);\r\nislandsnotableborder:list ofcarried100,000</h3>\n severalbecomesselect wedding00.htmlmonarchoff theteacherhighly biologylife ofor evenrise of»plusonehunting(thoughDouglasjoiningcirclesFor theAncientVietnamvehiclesuch ascrystalvalue =Windowsenjoyeda smallassumed<a id=\"foreign All rihow theDisplayretiredhoweverhidden;battlesseekingcabinetwas notlook atconductget theJanuaryhappensturninga:hoverOnline French lackingtypicalextractenemieseven ifgeneratdecidedare not/searchbeliefs-image:locatedstatic.login\">convertviolententeredfirst\">circuitFinlandchemistshe was10px;\">as suchdivided</span>will beline ofa greatmystery/index.fallingdue to railwaycollegemonsterdescentit withnuclearJewish protestBritishflowerspredictreformsbutton who waslectureinstantsuicidegenericperiodsmarketsSocial fishingcombinegraphicwinners<br /><by the NaturalPrivacycookiesoutcomeresolveSwedishbrieflyPersianso muchCenturydepictscolumnshousingscriptsnext tobearingmappingrevisedjQuery(-width:title\">tooltipSectiondesignsTurkishyounger.match(})();\n\nburningoperatedegreessource=Richardcloselyplasticentries</tr>\r\ncolor:#ul id=\"possessrollingphysicsfailingexecutecontestlink toDefault<br />\n: true,chartertourismclassicproceedexplain</h1>\r\nonline.?xml vehelpingdiamonduse theairlineend -->).attr(readershosting#ffffffrealizeVincentsignals src=\"/ProductdespitediversetellingPublic held inJoseph theatreaffects<style>a largedoesn\'tlater, ElementfaviconcreatorHungaryAirportsee theso thatMichaelSystemsPrograms, and width=e"tradingleft\">\npersonsGolden Affairsgrammarformingdestroyidea ofcase ofoldest this is.src = cartoonregistrCommonsMuslimsWhat isin manymarkingrevealsIndeed,equally/show_aoutdoorescape(Austriageneticsystem,In the sittingHe alsoIslandsAcademy\n\t\t<!--Daniel bindingblock\">imposedutilizeAbraham(except{width:putting).html(|| [];\nDATA[ *kitchenmountedactual dialectmainly _blank\'installexpertsif(typeIt also© \">Termsborn inOptionseasterntalkingconcerngained ongoingjustifycriticsfactoryits ownassaultinvitedlastinghis ownhref=\"/\" rel=\"developconcertdiagramdollarsclusterphp?id=alcohol);})();using a><span>vesselsrevivalAddressamateurandroidallegedillnesswalkingcentersqualifymatchesunifiedextinctDefensedied in\n\t<!-- customslinkingLittle Book ofeveningmin.js?are thekontakttoday\'s.html\" target=wearingAll Rig;\n})();raising Also, crucialabout\">declare-->\n<scfirefoxas muchappliesindex, s, but type = \n\r\n<!--towardsRecordsPrivateForeignPremierchoicesVirtualreturnsCommentPoweredinline;povertychamberLiving volumesAnthonylogin\" RelatedEconomyreachescuttinggravitylife inChapter-shadowNotable</td>\r\n returnstadiumwidgetsvaryingtravelsheld bywho arework infacultyangularwho hadairporttown of\n\nSome \'click\'chargeskeywordit willcity of(this);Andrew unique checkedor more300px; return;rsion=\"pluginswithin herselfStationFederalventurepublishsent totensionactresscome tofingersDuke ofpeople,exploitwhat isharmonya major\":\"httpin his menu\">\nmonthlyofficercouncilgainingeven inSummarydate ofloyaltyfitnessand wasemperorsupremeSecond hearingRussianlongestAlbertalateralset of small\">.appenddo withfederalbank ofbeneathDespiteCapitalgrounds), and percentit fromclosingcontainInsteadfifteenas well.yahoo.respondfighterobscurereflectorganic= Math.editingonline paddinga wholeonerroryear ofend of barrierwhen itheader home ofresumedrenamedstrong>heatingretainscloudfrway of March 1knowingin partBetweenlessonsclosestvirtuallinks\">crossedEND -->famous awardedLicenseHealth fairly wealthyminimalAfricancompetelabel\">singingfarmersBrasil)discussreplaceGregoryfont copursuedappearsmake uproundedboth ofblockedsaw theofficescoloursif(docuwhen heenforcepush(fuAugust UTF-8\">Fantasyin mostinjuredUsuallyfarmingclosureobject defenceuse of Medical<body>\nevidentbe usedkeyCodesixteenIslamic#000000entire widely active (typeofone cancolor =speakerextendsPhysicsterrain<tbody>funeralviewingmiddle cricketprophetshifteddoctorsRussell targetcompactalgebrasocial-bulk ofman and</td>\n he left).val()false);logicalbankinghome tonaming Arizonacredits);\n});\nfounderin turnCollinsbefore But thechargedTitle\">CaptainspelledgoddessTag -->Adding:but wasRecent patientback in=false&Lincolnwe knowCounterJudaismscript altered\']);\n has theunclearEvent\',both innot all\n\n<!-- placinghard to centersort ofclientsstreetsBernardassertstend tofantasydown inharbourFreedomjewelry/about..searchlegendsis mademodern only ononly toimage\" linear painterand notrarely acronymdelivershorter00&as manywidth=\"/* <![Ctitle =of the lowest picked escapeduses ofpeoples PublicMatthewtacticsdamagedway forlaws ofeasy to windowstrong simple}catch(seventhinfoboxwent topaintedcitizenI don\'tretreat. Some ww.\");\nbombingmailto:made in. Many carries||{};wiwork ofsynonymdefeatsfavoredopticalpageTraunless sendingleft\"><comScorAll thejQuery.touristClassicfalse\" Wilhelmsuburbsgenuinebishops.split(global followsbody ofnominalContactsecularleft tochiefly-hidden-banner</li>\n\n. When in bothdismissExplorealways via thespaC1olwelfareruling arrangecaptainhis sonrule ofhe tookitself,=0&(calledsamplesto makecom/pagMartin Kennedyacceptsfull ofhandledBesides//--></able totargetsessencehim to its by common.mineralto takeways tos.org/ladvisedpenaltysimple:if theyLettersa shortHerbertstrikes groups.lengthflightsoverlapslowly lesser social </p>\n\t\tit intoranked rate oful>\r\n attemptpair ofmake itKontaktAntoniohaving ratings activestreamstrapped\").css(hostilelead tolittle groups,Picture-->\r\n\r\n rows=\" objectinverse<footerCustomV><\\/scrsolvingChamberslaverywoundedwhereas!= \'undfor allpartly -right:Arabianbacked centuryunit ofmobile-Europe,is homerisk ofdesiredClintoncost ofage of become none ofp"Middle ead\')[0Criticsstudios>©group\">assemblmaking pressedwidget.ps:\" ? rebuiltby someFormer editorsdelayedCanonichad thepushingclass=\"but arepartialBabylonbottom carrierCommandits useAs withcoursesa thirddenotesalso inHouston20px;\">accuseddouble goal ofFamous ).bind(priests Onlinein Julyst + \"gconsultdecimalhelpfulrevivedis veryr\'+\'iptlosing femalesis alsostringsdays ofarrivalfuture <objectforcingString(\" />\n\t\there isencoded. The balloondone by/commonbgcolorlaw of Indianaavoidedbut the2px 3pxjquery.after apolicy.men andfooter-= true;for usescreen.Indian image =family,http:// driverseternalsame asnoticedviewers})();\n is moreseasonsformer the newis justconsent Searchwas thewhy theshippedbr><br>width: height=made ofcuisineis thata very Admiral fixed;normal MissionPress, ontariocharsettry to invaded=\"true\"spacingis mosta more totallyfall of});\r\n immensetime inset outsatisfyto finddown tolot of Playersin Junequantumnot thetime todistantFinnishsrc = (single help ofGerman law andlabeledforestscookingspace\">header-well asStanleybridges/globalCroatia About [0];\n it, andgroupedbeing a){throwhe madelighterethicalFFFFFF\"bottom\"like a employslive inas seenprintermost ofub-linkrejectsand useimage\">succeedfeedingNuclearinformato helpWomen\'sNeitherMexicanprotein<table by manyhealthylawsuitdevised.push({sellerssimply Through.cookie Image(older\">us.js\"> Since universlarger open to!-- endlies in\']);\r\n marketwho is (\"DOMComanagedone fortypeof Kingdomprofitsproposeto showcenter;made itdressedwere inmixtureprecisearisingsrc = \'make a securedBaptistvoting \n\t\tvar March 2grew upClimate.removeskilledway the</head>face ofacting right\">to workreduceshas haderectedshow();action=book ofan area== \"htt<header\n<html>conformfacing cookie.rely onhosted .customhe wentbut forspread Family a meansout theforums.footage\">MobilClements\" id=\"as highintense--><!--female is seenimpliedset thea stateand hisfastestbesidesbutton_bounded\"><img Infoboxevents,a youngand areNative cheaperTimeoutand hasengineswon the(mostlyright: find a -bottomPrince area ofmore ofsearch_nature,legallyperiod,land ofor withinducedprovingmissilelocallyAgainstthe wayk"px;\">\r\npushed abandonnumeralCertainIn thismore inor somename isand, incrownedISBN 0-createsOctobermay notcenter late inDefenceenactedwish tobroadlycoolingonload=it. TherecoverMembersheight assumes<html>\npeople.in one =windowfooter_a good reklamaothers,to this_cookiepanel\">London,definescrushedbaptismcoastalstatus title\" move tolost inbetter impliesrivalryservers SystemPerhapses and contendflowinglasted rise inGenesisview ofrising seem tobut in backinghe willgiven agiving cities.flow of Later all butHighwayonly bysign ofhe doesdiffersbattery&lasinglesthreatsintegertake onrefusedcalled =US&See thenativesby thissystem.head of:hover,lesbiansurnameand allcommon/header__paramsHarvard/pixel.removalso longrole ofjointlyskyscraUnicodebr />\r\nAtlantanucleusCounty,purely count\">easily build aonclicka givenpointerh"events else {\nditionsnow the, with man whoorg/Webone andcavalryHe diedseattle00,000 {windowhave toif(windand itssolely m"renewedDetroitamongsteither them inSenatorUs</a><King ofFrancis-produche usedart andhim andused byscoringat hometo haverelatesibilityfactionBuffalolink\"><what hefree toCity ofcome insectorscountedone daynervoussquare };if(goin whatimg\" alis onlysearch/tuesdaylooselySolomonsexual - <a hrmedium\"DO NOT France,with a war andsecond take a >\r\n\r\n\r\nmarket.highwaydone inctivity\"last\">obligedrise to\"undefimade to Early praisedin its for hisathleteJupiterYahoo! termed so manyreally s. The a woman?value=direct right\" bicycleacing=\"day andstatingRather,higher Office are nowtimes, when a pay foron this-link\">;borderaround annual the Newput the.com\" takin toa brief(in thegroups.; widthenzymessimple in late{returntherapya pointbanninginks\">\n();\" rea place\\u003Caabout atr>\r\n\t\tccount gives a<SCRIPTRailwaythemes/toolboxById(\"xhumans,watchesin some if (wicoming formats Under but hashanded made bythan infear ofdenoted/iframeleft involtagein eacha"base ofIn manyundergoregimesaction </p>\r\n<ustomVa;></importsor thatmostly &re size=\"</a></ha classpassiveHost = WhetherfertileVarious=[];(fucameras/></td>acts asIn some>\r\n\r\n<!organis <br />BeijingcatalC deutscheuropeueuskaragaeilgesvenskaespaC1amensajeusuariotrabajomC)xicopC!ginasiempresistemaoctubreduranteaC1adirempresamomentonuestroprimeratravC)sgraciasnuestraprocesoestadoscalidadpersonanC:meroacuerdomC:sicamiembroofertasalgunospaC-sesejemploderechoademC!sprivadoagregarenlacesposiblehotelessevillaprimeroC:ltimoeventosarchivoculturamujeresentradaanuncioembargomercadograndesestudiomejoresfebrerodiseC1oturismocC3digoportadaespaciofamiliaantoniopermiteguardaralgunaspreciosalguiensentidovisitastC-tuloconocersegundoconsejofranciaminutossegundatenemosefectosmC!lagasesiC3nrevistagranadacompraringresogarcC-aacciC3necuadorquienesinclusodeberC!materiahombresmuestrapodrC-amaC1anaC:ltimaestamosoficialtambienningC:nsaludospodemosmejorarpositionbusinesshomepagesecuritylanguagestandardcampaignfeaturescategoryexternalchildrenreservedresearchexchangefavoritetemplatemilitaryindustryservicesmaterialproductsz-index:commentssoftwarecompletecalendarplatformarticlesrequiredmovementquestionbuildingpoliticspossiblereligionphysicalfeedbackregisterpicturesdisabledprotocolaudiencesettingsactivityelementslearninganythingabstractprogressoverviewmagazineeconomictrainingpressurevarious <strong>propertyshoppingtogetheradvancedbehaviordownloadfeaturedfootballselectedLanguagedistanceremembertrackingpasswordmodifiedstudentsdirectlyfightingnortherndatabasefestivalbreakinglocationinternetdropdownpracticeevidencefunctionmarriageresponseproblemsnegativeprogramsanalysisreleasedbanner\">purchasepoliciesregionalcreativeargumentbookmarkreferrerchemicaldivisioncallbackseparateprojectsconflicthardwareinterestdeliverymountainobtained= false;for(var acceptedcapacitycomputeridentityaircraftemployedproposeddomesticincludesprovidedhospitalverticalcollapseapproachpartnerslogo\"><adaughterauthor\" culturalfamilies/images/assemblypowerfulteachingfinisheddistrictcriticalcgi-bin/purposesrequireselectionbecomingprovidesacademicexerciseactuallymedicineconstantaccidentMagazinedocumentstartingbottom\">observed: "extendedpreviousSoftwarecustomerdecisionstrengthdetailedslightlyplanningtextareacurrencyeveryonestraighttransferpositiveproducedheritageshippingabsolutereceivedrelevantbutton\" violenceanywherebenefitslaunchedrecentlyalliancefollowedmultiplebulletinincludedoccurredinternal$(this).republic><tr><tdcongressrecordedultimatesolution<ul id=\"discoverHome</a>websitesnetworksalthoughentirelymemorialmessagescontinueactive\">somewhatvictoriaWestern title=\"LocationcontractvisitorsDownloadwithout right\">\nmeasureswidth = variableinvolvedvirginianormallyhappenedaccountsstandingnationalRegisterpreparedcontrolsaccuratebirthdaystrategyofficialgraphicscriminalpossiblyconsumerPersonalspeakingvalidateachieved.jpg\" />machines</h2>\n keywordsfriendlybrotherscombinedoriginalcomposedexpectedadequatepakistanfollow\" valuable</label>relativebringingincreasegovernorplugins/List of Header\">\" name=\" ("graduate</head>\ncommercemalaysiadirectormaintain;height:schedulechangingback to catholicpatternscolor: #greatestsuppliesreliable</ul>\n\t\t<select citizensclothingwatching<li id=\"specificcarryingsentence<center>contrastthinkingcatch(e)southernMichael merchantcarouselpadding:interior.split(\"lizationOctober ){returnimproved-->\n\ncoveragechairman.png\" />subjectsRichard whateverprobablyrecoverybaseballjudgmentconnect..css\" /> websitereporteddefault\"/></a>\r\nelectricscotlandcreationquantity. ISBN 0did not instance-search-\" lang=\"speakersComputercontainsarchivesministerreactiondiscountItalianocriteriastrongly: \'http:\'script\'coveringofferingappearedBritish identifyFacebooknumerousvehiclesconcernsAmericanhandlingdiv id=\"William provider_contentaccuracysection andersonflexibleCategorylawrence<script>layout=\"approved maximumheader\"></table>Serviceshamiltoncurrent canadianchannels/themes//articleoptionalportugalvalue=\"\"intervalwirelessentitledagenciesSearch\" measuredthousandspending…new Date\" size=\"pageNamemiddle\" \" /></a>hidden\">sequencepersonaloverflowopinionsillinoislinks\">\n\t<title>versionssaturdayterminalitempropengineersectionsdesignerproposal=\"false\"EspaC1olreleasessubmit\" er"additionsymptomsorientedresourceright\"><pleasurestationshistory.leaving border=contentscenter\">.\n\nSome directedsuitablebulgaria.show();designedGeneral conceptsExampleswilliamsOriginal\"><span>search\">operatorrequestsa "allowingDocumentrevision. \n\nThe yourselfContact michiganEnglish columbiapriorityprintingdrinkingfacilityreturnedContent officersRussian generate-8859-1\"indicatefamiliar qualitymargin:0 contentviewportcontacts-title\">portable.length eligibleinvolvesatlanticonload=\"default.suppliedpaymentsglossary\n\nAfter guidance</td><tdencodingmiddle\">came to displaysscottishjonathanmajoritywidgets.clinicalthailandteachers<head>\n\taffectedsupportspointer;toString</small>oklahomawill be investor0\" alt=\"holidaysResourcelicensed (which . After considervisitingexplorerprimary search\" android\"quickly meetingsestimate;return ;color:# height=approval, " checked.min.js\"magnetic></a></hforecast. While thursdaydvertiseéhasClassevaluateorderingexistingpatients Online coloradoOptions\"campbell<!-- end</span><<br />\r\n_popups|sciences," quality Windows assignedheight: <b classle" value=\" Companyexamples<iframe believespresentsmarshallpart of properly).\n\nThe taxonomymuch of </span>\n\" data-srtuguC*sscrollTo project<head>\r\nattorneyemphasissponsorsfancyboxworld\'s wildlifechecked=sessionsprogrammpx;font- Projectjournalsbelievedvacationthompsonlightingand the special border=0checking</tbody><button Completeclearfix\n<head>\narticle <sectionfindingsrole in popular Octoberwebsite exposureused to changesoperatedclickingenteringcommandsinformed numbers </div>creatingonSubmitmarylandcollegesanalyticlistingscontact.loggedInadvisorysiblingscontent\"s")s. This packagescheckboxsuggestspregnanttomorrowspacing=icon.pngjapanesecodebasebutton\">gamblingsuch as , while </span> missourisportingtop:1px .</span>tensionswidth=\"2lazyloadnovemberused in height=\"cript\">\n </<tr><td height:2/productcountry include footer\" <!-- title\"></jquery.</form>\n(g.\u0000d=\u0013)(g9\u0001i+\u0014)hrvatskiitalianoromC\"nD\u0003tC<rkC\'eX\'X1X/Y\btambiC)nnoticiasmensajespersonasderechosnacionalserviciocontactousuariosprogramagobiernoempresasanunciosvalenciacolombiadespuC)sdeportesproyectoproductopC:bliconosotroshistoriapresentemillonesmediantepreguntaanteriorrecursosproblemasantiagonuestrosopiniC3nimprimirmientrasamC)ricavendedorsociedadrespectorealizarregistropalabrasinterC)sentoncesespecialmiembrosrealidadcC3rdobazaragozapC!ginassocialesbloqueargestiC3nalquilersistemascienciascompletoversiC3ncompletaestudiospC:blicaobjetivoalicantebuscadorcantidadentradasaccionesarchivossuperiormayorC-aalemaniafunciC3nC:ltimoshaciendoaquellosediciC3nfernandoambientefacebooknuestrasclientesprocesosbastantepresentareportarcongresopublicarcomerciocontratojC3venesdistritotC)cnicaconjuntoenergC-atrabajarasturiasrecienteutilizarboletC-nsalvadorcorrectatrabajosprimerosnegocioslibertaddetallespantallaprC3ximoalmerC-aanimalesquiC)nescorazC3nsecciC3nbuscandoopcionesexteriorconceptotodavC-agalerC-aescribirmedicinalicenciaconsultaaspectoscrC-ticadC3laresjusticiadeberC!nperC-odonecesitamantenerpequeC1orecibidatribunaltenerifecanciC3ncanariasdescargadiversosmallorcarequieretC)cnicodeberC-aviviendafinanzasadelantefuncionaconsejosdifC-cilciudadesantiguasavanzadatC)rminounidadessC!nchezcampaC1asoftonicrevistascontienesectoresmomentosfacultadcrC)ditodiversassupuestofactoressegundospequeC1aP3P>P4P0P5Q\u0001P;P8P5Q\u0001Q\u0002Q\fP1Q\u000bP;P>P1Q\u000bQ\u0002Q\fQ\rQ\u0002P>P<P\u0015Q\u0001P;P8Q\u0002P>P3P>P<P5P=Q\u000fP2Q\u0001P5Q\u0005Q\rQ\u0002P>P9P4P0P6P5P1Q\u000bP;P8P3P>P4Q\u0003P4P5P=Q\fQ\rQ\u0002P>Q\u0002P1Q\u000bP;P0Q\u0001P5P1Q\u000fP>P4P8P=Q\u0001P5P1P5P=P0P4P>Q\u0001P0P9Q\u0002Q\u0004P>Q\u0002P>P=P5P3P>Q\u0001P2P>P8Q\u0001P2P>P9P8P3Q\u0000Q\u000bQ\u0002P>P6P5P2Q\u0001P5P<Q\u0001P2P>Q\u000eP;P8Q\bQ\fQ\rQ\u0002P8Q\u0005P?P>P:P0P4P=P5P9P4P>P<P0P<P8Q\u0000P0P;P8P1P>Q\u0002P5P<Q\u0003Q\u0005P>Q\u0002Q\u000fP4P2Q\u0003Q\u0005Q\u0001P5Q\u0002P8P;Q\u000eP4P8P4P5P;P>P<P8Q\u0000P5Q\u0002P5P1Q\u000fQ\u0001P2P>P5P2P8P4P5Q\u0007P5P3P>Q\rQ\u0002P8P<Q\u0001Q\u0007P5Q\u0002Q\u0002P5P<Q\u000bQ\u0006P5P=Q\u000bQ\u0001Q\u0002P0P;P2P5P4Q\fQ\u0002P5P<P5P2P>P4Q\u000bQ\u0002P5P1P5P2Q\u000bQ\bP5P=P0P<P8Q\u0002P8P?P0Q\u0002P>P<Q\u0003P?Q\u0000P0P2P;P8Q\u0006P0P>P4P=P0P3P>P4Q\u000bP7P=P0Q\u000eP<P>P3Q\u0003P4Q\u0000Q\u0003P3P2Q\u0001P5P9P8P4P5Q\u0002P:P8P=P>P>P4P=P>P4P5P;P0P4P5P;P5Q\u0001Q\u0000P>P:P8Q\u000eP=Q\u000fP2P5Q\u0001Q\fP\u0015Q\u0001Q\u0002Q\fQ\u0000P0P7P0P=P0Q\bP8X\'Y\u0004Y\u0004Y\u0007X\'Y\u0004X*Y\nX,Y\u0005Y\nX9X.X\'X5X)X\'Y\u0004X0Y\nX9Y\u0004Y\nY\u0007X,X/Y\nX/X\'Y\u0004X\"Y\u0006X\'Y\u0004X1X/X*X-Y\u0003Y\u0005X5Y\u0001X-X)Y\u0003X\'Y\u0006X*X\'Y\u0004Y\u0004Y\nY\nY\u0003Y\bY\u0006X4X(Y\u0003X)Y\u0001Y\nY\u0007X\'X(Y\u0006X\'X*X-Y\bX\'X!X#Y\u0003X+X1X.Y\u0004X\'Y\u0004X\'Y\u0004X-X(X/Y\u0004Y\nY\u0004X/X1Y\bX3X\'X6X:X7X*Y\u0003Y\bY\u0006Y\u0007Y\u0006X\'Y\u0003X3X\'X-X)Y\u0006X\'X/Y\nX\'Y\u0004X7X(X9Y\u0004Y\nY\u0003X4Y\u0003X1X\'Y\nY\u0005Y\u0003Y\u0006Y\u0005Y\u0006Y\u0007X\'X4X1Y\u0003X)X1X&Y\nX3Y\u0006X4Y\nX7Y\u0005X\'X0X\'X\'Y\u0004Y\u0001Y\u0006X4X(X\'X(X*X9X(X1X1X-Y\u0005X)Y\u0003X\'Y\u0001X)Y\nY\u0002Y\bY\u0004Y\u0005X1Y\u0003X2Y\u0003Y\u0004Y\u0005X)X#X-Y\u0005X/Y\u0002Y\u0004X(Y\nY\nX9Y\u0006Y\nX5Y\bX1X)X7X1Y\nY\u0002X4X\'X1Y\u0003X,Y\bX\'Y\u0004X#X.X1Y\tY\u0005X9Y\u0006X\'X\'X(X-X+X9X1Y\bX6X(X4Y\u0003Y\u0004Y\u0005X3X,Y\u0004X(Y\u0006X\'Y\u0006X.X\'Y\u0004X/Y\u0003X*X\'X(Y\u0003Y\u0004Y\nX)X(X/Y\bY\u0006X#Y\nX6X\'Y\nY\bX,X/Y\u0001X1Y\nY\u0002Y\u0003X*X(X*X#Y\u0001X6Y\u0004Y\u0005X7X(X.X\'Y\u0003X+X1X(X\'X1Y\u0003X\'Y\u0001X6Y\u0004X\'X-Y\u0004Y\tY\u0006Y\u0001X3Y\u0007X#Y\nX\'Y\u0005X1X/Y\bX/X#Y\u0006Y\u0007X\'X/Y\nY\u0006X\'X\'Y\u0004X\'Y\u0006Y\u0005X9X1X6X*X9Y\u0004Y\u0005X/X\'X.Y\u0004Y\u0005Y\u0005Y\u0003Y\u0006\u0000\u0000\u0000\u0000\u0000\u0000\u0000\u0000\u0001\u0000\u0001\u0000\u0001\u0000\u0001\u0000\u0002\u0000\u0002\u0000\u0002\u0000\u0002\u0000\u0004\u0000\u0004\u0000\u0004\u0000\u0004\u0000\u0000\u0001\u0002\u0003\u0004\u0005\u0006\u0007\u0007\u0006\u0005\u0004\u0003\u0002\u0001\u0000\b\t\n\u000b\f\r\u000e\u000f\u000f\u000e\r\f\u000b\n\t\b\u0010\u0011\u0012\u0013\u0014\u0015\u0016\u0017\u0017\u0016\u0015\u0014\u0013\u0012\u0011\u0010\u0018\u0019\u001a\u001b\u001c\u001d\u001e\u001f\u001f\u001e\u001d\u001c\u001b\u001a\u0019\u0018\u007f\u007f\u007f\u007f\u0000\u0000\u0000\u0000\u0000\u0000\u0000\u0000\u007f\u007f\u007f\u007f\u0001\u0000\u0000\u0000\u0002\u0000\u0000\u0000\u0002\u0000\u0000\u0000\u0001\u0000\u0000\u0000\u0001\u0000\u0000\u0000\u0003\u0000\u0000\u0000\u007f\u007f\u0000\u0001\u0000\u0000\u0000\u0001\u0000\u0000\u007f\u007f\u0000\u0001\u0000\u0000\u0000\b\u0000\b\u0000\b\u0000\b\u0000\u0000\u0000\u0001\u0000\u0002\u0000\u0003\u0000\u0004\u0000\u0005\u0000\u0006\u0000\u0007resourcescountriesquestionsequipmentcommunityavailablehighlightDTD/xhtmlmarketingknowledgesomethingcontainerdirectionsubscribeadvertisecharacter\" value=\"</select>Australia\" class=\"situationauthorityfollowingprimarilyoperationchallengedevelopedanonymousfunction functionscompaniesstructureagreement\" title=\"potentialeducationargumentssecondarycopyrightlanguagesexclusivecondition</form>\r\nstatementattentionBiography} else {\nsolutionswhen the Analyticstemplatesdangeroussatellitedocumentspublisherimportantprototypeinfluence»</effectivegenerallytransformbeautifultransportorganizedpublishedprominentuntil thethumbnailNational .focus();over the migrationannouncedfooter\">\nexceptionless thanexpensiveformationframeworkterritoryndicationcurrentlyclassNamecriticismtraditionelsewhereAlexanderappointedmaterialsbroadcastmentionedaffiliate</option>treatmentdifferent/default.Presidentonclick=\"biographyotherwisepermanentFranC\'aisHollywoodexpansionstandards</style>\nreductionDecember preferredCambridgeopponentsBusiness confusion>\n<title>presentedexplaineddoes not worldwideinterfacepositionsnewspaper</table>\nmountainslike the essentialfinancialselectionaction=\"/abandonedEducationparseInt(stabilityunable to</title>\nrelationsNote thatefficientperformedtwo yearsSince thethereforewrapper\">alternateincreasedBattle ofperceivedtrying tonecessaryportrayedelectionsElizabeth</iframe>discoveryinsurances.length;legendaryGeographycandidatecorporatesometimesservices.inherited</strong>CommunityreligiouslocationsCommitteebuildingsthe worldno longerbeginningreferencecannot befrequencytypicallyinto the relative;recordingpresidentinitiallytechniquethe otherit can beexistenceunderlinethis timetelephoneitemscopepracticesadvantage);return For otherprovidingdemocracyboth the extensivesufferingsupportedcomputers functionpracticalsaid thatit may beEnglish</from the scheduleddownloads</label>\nsuspectedmargin: 0spiritual</head>\n\nmicrosoftgraduallydiscussedhe becameexecutivejquery.jshouseholdconfirmedpurchasedliterallydestroyedup to thevariationremainingit is notcenturiesJapanese among thecompletedalgorithminterestsrebellionundefinedencourageresizableinvolvingsensitiveuniversalprovision(althoughfeaturingconducted), which continued-header\">February numerous overflow:componentfragmentsexcellentcolspan=\"technicalnear the Advanced source ofexpressedHong Kong Facebookmultiple mechanismelevationoffensive</form>\n\tsponsoreddocument.or "there arethose whomovementsprocessesdifficultsubmittedrecommendconvincedpromoting\" width=\".replace(classicalcoalitionhis firstdecisionsassistantindicatedevolution-wrapper\"enough toalong thedelivered-->\r\n<!--American protectedNovember </style><furnitureInternet onblur=\"suspendedrecipientbased on Moreover,abolishedcollectedwere madeemotionalemergencynarrativeadvocatespx;bordercommitteddir=\"ltr\"employeesresearch. selectedsuccessorcustomersdisplayedSeptemberaddClass(Facebook suggestedand lateroperatingelaborateSometimesInstitutecertainlyinstalledfollowersJerusalemthey havecomputinggeneratedprovincesguaranteearbitraryrecognizewanted topx;width:theory ofbehaviourWhile theestimatedbegan to it becamemagnitudemust havemore thanDirectoryextensionsecretarynaturallyoccurringvariablesgiven theplatform.</label><failed tocompoundskinds of societiesalongside -->\n\nsouthwestthe rightradiationmay have unescape(spoken in\" href=\"/programmeonly the come fromdirectoryburied ina similarthey were</font></Norwegianspecifiedproducingpassenger(new DatetemporaryfictionalAfter theequationsdownload.regularlydeveloperabove thelinked tophenomenaperiod oftooltip\">substanceautomaticaspect ofAmong theconnectedestimatesAir Forcesystem ofobjectiveimmediatemaking itpaintingsconqueredare stillproceduregrowth ofheaded byEuropean divisionsmoleculesfranchiseintentionattractedchildhoodalso useddedicatedsingaporedegree offather ofconflicts</a></p>\ncame fromwere usednote thatreceivingExecutiveeven moreaccess tocommanderPoliticalmusiciansdeliciousprisonersadvent ofUTF-8\" /><![CDATA[\">ContactSouthern bgcolor=\"series of. It was in Europepermittedvalidate.appearingofficialsseriously-languageinitiatedextendinglong-terminflationsuch thatgetCookiemarked by</button>implementbut it isincreasesdown the requiringdependent-->\n<!-- interviewWith the copies ofconsensuswas builtVenezuela(formerlythe statepersonnelstrategicfavour ofinventionWikipediacontinentvirtuallywhich wasprincipleComplete identicalshow thatprimitiveaway frommolecularpreciselydissolvedUnder theversion=\"> </It is the This is will haveorganismssome timeFriedrichwas firstthe only fact thatform id=\"precedingTechnicalphysicistoccurs innavigatorsection\">span id=\"sought tobelow thesurviving}</style>his deathas in thecaused bypartiallyexisting using thewas givena list oflevels ofnotion ofOfficial dismissedscientistresemblesduplicateexplosiverecoveredall othergalleries{padding:people ofregion ofaddressesassociateimg alt=\"in modernshould bemethod ofreportingtimestampneeded tothe Greatregardingseemed toviewed asimpact onidea thatthe Worldheight ofexpandingThese arecurrent\">carefullymaintainscharge ofClassicaladdressedpredictedownership<div id=\"right\">\r\nresidenceleave thecontent\">are often })();\r\nprobably Professor-button\" respondedsays thathad to beplaced inHungarianstatus ofserves asUniversalexecutionaggregatefor whichinfectionagreed tohowever, popular\">placed onconstructelectoralsymbol ofincludingreturn toarchitectChristianprevious living ineasier toprofessor\n<!-- effect ofanalyticswas takenwhere thetook overbelief inAfrikaansas far aspreventedwork witha special<fieldsetChristmasRetrieved\n\nIn the back intonortheastmagazines><strong>committeegoverninggroups ofstored inestablisha generalits firsttheir ownpopulatedan objectCaribbeanallow thedistrictswisconsinlocation.; width: inhabitedSocialistJanuary 1</footer>similarlychoice ofthe same specific business The first.length; desire todeal withsince theuserAgentconceivedindex.phpas "engage inrecently,few yearswere also\n<head>\n<edited byare knowncities inaccesskeycondemnedalso haveservices,family ofSchool ofconvertednature of languageministers</object>there is a popularsequencesadvocatedThey wereany otherlocation=enter themuch morereflectedwas namedoriginal a typicalwhen theyengineerscould notresidentswednesdaythe third productsJanuary 2what theya certainreactionsprocessorafter histhe last contained\"></div>\n</a></td>depend onsearch\">\npieces ofcompetingReferencetennesseewhich has version=</span> <</header>gives thehistorianvalue=\"\">padding:0view thattogether,the most was foundsubset ofattack onchildren,points ofpersonal position:allegedlyClevelandwas laterand afterare givenwas stillscrollingdesign ofmakes themuch lessAmericans.\n\nAfter , but theMuseum oflouisiana(from theminnesotaparticlesa processDominicanvolume ofreturningdefensive00px|righmade frommouseover\" style=\"states of(which iscontinuesFranciscobuilding without awith somewho woulda form ofa part ofbefore itknown as Serviceslocation and oftenmeasuringand it ispaperbackvalues of\r\n<title>= window.determineer" played byand early</center>from thisthe threepower andof "innerHTML<a href=\"y:inline;Church ofthe eventvery highofficial -height: content=\"/cgi-bin/to createafrikaansesperantofranC\'aislatvieE!ulietuviE3D\feE!tinaD\reE!tina`9\u0004`8\u0017`8\"f\u0017%f\u001c,h*\u001eg.\u0000d=\u0013e-\u0017g9\u0001i+\u0014e-\u0017m\u0015\u001cj5-l\u00164d8:d;\u0000d9\bh.!g.\u0017f\u001c:g,\u0014h.0f\u001c,h(\u000eh+\u0016e\r\u0000f\u001c\re\n!e\u0019(d:\u0012h\u0001\u0014g=\u0011f\b?e\u001c0d:\'d?1d9\u0010i\u0003(e\u0007:g\t\bg$>f\u000e\u0012h!\ff&\u001ci\u0003(h\u0010=f <h?\u001bd8\u0000f-%f\u0014/d;\u0018e.\u001di*\fh/\u0001g \u0001e\'\u0014e\u0011\u0018d<\u001af\u00150f\r.e:\u0013f6\bh49h\u0000\u0005e\n\u001ee\u0005,e.$h.(h.:e\f:f71e\u001c3e8\u0002f\u0012-f\u0014>e\u0019(e\f\u0017d:,e8\u0002e$\'e-&g\u0014\u001fh6\nf\u001d%h6\ng.!g\u0010\u0006e\u0011\u0018d?!f\u0001/g=\u0011serviciosartC-culoargentinabarcelonacualquierpublicadoproductospolC-ticarespuestawikipediasiguientebC:squedacomunidadseguridadprincipalpreguntascontenidorespondervenezuelaproblemasdiciembrerelaciC3nnoviembresimilaresproyectosprogramasinstitutoactividadencuentraeconomC-aimC!genescontactardescargarnecesarioatenciC3ntelC)fonocomisiC3ncancionescapacidadencontraranC!lisisfavoritostC)rminosprovinciaetiquetaselementosfuncionesresultadocarC!cterpropiedadprincipionecesidadmunicipalcreaciC3ndescargaspresenciacomercialopinionesejercicioeditorialsalamancagonzC!lezdocumentopelC-cularecientesgeneralestarragonaprC!cticanovedadespropuestapacientestC)cnicasobjetivoscontactos`$.`%\u0007`$\u0002`$2`$?`$\u000f`$9`%\b`$\u0002`$\u0017`$/`$>`$8`$>`$%`$\u000f`$5`$\u0002`$0`$9`%\u0007`$\u0015`%\u000b`$\b`$\u0015`%\u0001`$\u001b`$0`$9`$>`$,`$>`$&`$\u0015`$9`$>`$8`$-`%\u0000`$9`%\u0001`$\u000f`$0`$9`%\u0000`$.`%\b`$\u0002`$&`$?`$(`$,`$>`$$diplodocs`$8`$.`$/`$0`%\u0002`$*`$(`$>`$.`$*`$$`$>`$+`$?`$0`$\u0014`$8`$$`$$`$0`$9`$2`%\u000b`$\u0017`$9`%\u0001`$\u0006`$,`$>`$0`$&`%\u0007`$6`$9`%\u0001`$\b`$\u0016`%\u0007`$2`$/`$&`$?`$\u0015`$>`$.`$5`%\u0007`$,`$$`%\u0000`$(`$,`%\u0000`$\u001a`$.`%\f`$$`$8`$>`$2`$2`%\u0007`$\u0016`$\u001c`%\t`$,`$.`$&`$&`$$`$%`$>`$(`$9`%\u0000`$6`$9`$0`$\u0005`$2`$\u0017`$\u0015`$-`%\u0000`$(`$\u0017`$0`$*`$>`$8`$0`$>`$$`$\u0015`$?`$\u000f`$\t`$8`%\u0007`$\u0017`$/`%\u0000`$9`%\u0002`$\u0001`$\u0006`$\u0017`%\u0007`$\u001f`%\u0000`$.`$\u0016`%\u000b`$\u001c`$\u0015`$>`$0`$\u0005`$-`%\u0000`$\u0017`$/`%\u0007`$$`%\u0001`$.`$5`%\u000b`$\u001f`$&`%\u0007`$\u0002`$\u0005`$\u0017`$0`$\u0010`$8`%\u0007`$.`%\u0007`$2`$2`$\u0017`$>`$9`$>`$2`$\n`$*`$0`$\u001a`$>`$0`$\u0010`$8`$>`$&`%\u0007`$0`$\u001c`$?`$8`$&`$?`$2`$,`$\u0002`$&`$,`$(`$>`$9`%\u0002`$\u0002`$2`$>`$\u0016`$\u001c`%\u0000`$$`$,`$\u001f`$(`$.`$?`$2`$\u0007`$8`%\u0007`$\u0006`$(`%\u0007`$(`$/`$>`$\u0015`%\u0001`$2`$2`%\t`$\u0017`$-`$>`$\u0017`$0`%\u0007`$2`$\u001c`$\u0017`$9`$0`$>`$.`$2`$\u0017`%\u0007`$*`%\u0007`$\u001c`$9`$>`$%`$\u0007`$8`%\u0000`$8`$9`%\u0000`$\u0015`$2`$>`$ `%\u0000`$\u0015`$9`$>`$\u0001`$&`%\u0002`$0`$$`$9`$$`$8`$>`$$`$/`$>`$&`$\u0006`$/`$>`$*`$>`$\u0015`$\u0015`%\f`$(`$6`$>`$.`$&`%\u0007`$\u0016`$/`$9`%\u0000`$0`$>`$/`$\u0016`%\u0001`$&`$2`$\u0017`%\u0000categoriesexperience</title>\r\nCopyright javascriptconditionseverything<p class=\"technologybackground<a class=\"management© 201javaScriptcharactersbreadcrumbthemselveshorizontalgovernmentCaliforniaactivitiesdiscoveredNavigationtransitionconnectionnavigationappearance</title><mcheckbox\" techniquesprotectionapparentlyas well asunt\', \'UA-resolutionoperationstelevisiontranslatedWashingtonnavigator. = window.impression<br>literaturepopulationbgcolor=\"#especially content=\"productionnewsletterpropertiesdefinitionleadershipTechnologyParliamentcomparisonul class=\".indexOf(\"conclusiondiscussioncomponentsbiologicalRevolution_containerunderstoodnoscript><permissioneach otheratmosphere onfocus=\"<form id=\"processingthis.valuegenerationConferencesubsequentwell-knownvariationsreputationphenomenondisciplinelogo.png\" (document,boundariesexpressionsettlementBackgroundout of theenterprise(\"https:\" unescape(\"password\" democratic<a href=\"/wrapper\">\nmembershiplinguisticpx;paddingphilosophyassistanceuniversityfacilitiesrecognizedpreferenceif (typeofmaintainedvocabularyhypothesis.submit();&nbsp;annotationbehind theFoundationpublisher\"assumptionintroducedcorruptionscientistsexplicitlyinstead ofdimensions onClick=\"considereddepartmentoccupationsoon afterinvestmentpronouncedidentifiedexperimentManagementgeographic\" height=\"link rel=\".replace(/depressionconferencepunishmenteliminatedresistanceadaptationoppositionwell knownsupplementdeterminedh1 class=\"0px;marginmechanicalstatisticscelebratedGovernment\n\nDuring tdevelopersartificialequivalentoriginatedCommissionattachment<span id=\"there wereNederlandsbeyond theregisteredjournalistfrequentlyall of thelang=\"en\" </style>\r\nabsolute; supportingextremely mainstream</strong> popularityemployment</table>\r\n colspan=\"</form>\n conversionabout the </p></div>integrated\" lang=\"enPortuguesesubstituteindividualimpossiblemultimediaalmost allpx solid #apart fromsubject toin Englishcriticizedexcept forguidelinesoriginallyremarkablethe secondh2 class=\"<a title=\"(includingparametersprohibited= \"http://dictionaryperceptionrevolutionfoundationpx;height:successfulsupportersmillenniumhis fatherthe "no-repeat;commercialindustrialencouragedamount of unofficialefficiencyReferencescoordinatedisclaimerexpeditiondevelopingcalculatedsimplifiedlegitimatesubstring(0\" class=\"completelyillustratefive yearsinstrumentPublishing1\" class=\"psychologyconfidencenumber of absence offocused onjoined thestructurespreviously></iframe>once againbut ratherimmigrantsof course,a group ofLiteratureUnlike the</a> \nfunction it was theConventionautomobileProtestantaggressiveafter the Similarly,\" /></div>collection\r\nfunctionvisibilitythe use ofvolunteersattractionunder the threatened*<![CDATA[importancein generalthe latter</form>\n</.indexOf(\'i = 0; i <differencedevoted totraditionssearch forultimatelytournamentattributesso-called }\n</style>evaluationemphasizedaccessible</section>successionalong withMeanwhile,industries</a><br />has becomeaspects ofTelevisionsufficientbasketballboth sidescontinuingan article<img alt=\"adventureshis mothermanchesterprinciplesparticularcommentaryeffects ofdecided to\"><strong>publishersJournal ofdifficultyfacilitateacceptablestyle.css\"\tfunction innovation>Copyrightsituationswould havebusinessesDictionarystatementsoften usedpersistentin Januarycomprising</title>\n\tdiplomaticcontainingperformingextensionsmay not beconcept of onclick=\"It is alsofinancial making theLuxembourgadditionalare calledengaged in\"script\");but it waselectroniconsubmit=\"\n<!-- End electricalofficiallysuggestiontop of theunlike theAustralianOriginallyreferences\n</head>\r\nrecognisedinitializelimited toAlexandriaretirementAdventuresfour years\n\n<!-- increasingdecorationh3 class=\"origins ofobligationregulationclassified(function(advantagesbeing the historians<base hrefrepeatedlywilling tocomparabledesignatednominationfunctionalinside therevelationend of thes for the authorizedrefused totake placeautonomouscompromisepolitical restauranttwo of theFebruary 2quality ofswfobject.understandnearly allwritten byinterviews\" width=\"1withdrawalfloat:leftis usuallycandidatesnewspapersmysteriousDepartmentbest knownparliamentsuppressedconvenientremembereddifferent systematichas led topropagandacontrolledinfluencesceremonialproclaimedProtectionli class=\"Scientificclass=\"no-trademarksmore than widespreadLiberationtook placeday of theas long asimprisonedAdditional\n<head>\n<mLaboratoryNovember 2exceptionsIndustrialvariety offloat: lefDuring theassessmenthave been deals withStatisticsoccurrence/ul></div>clearfix\">the publicmany yearswhich wereover time,synonymouscontent\">\npresumablyhis familyuserAgent.unexpectedincluding challengeda minorityundefined\"belongs totaken fromin Octoberposition: said to bereligious Federation rowspan=\"only a fewmeant thatled to the-->\r\n<div <fieldset>Archbishop class=\"nobeing usedapproachesprivilegesnoscript>\nresults inmay be theEaster eggmechanismsreasonablePopulationCollectionselected\">noscript>\r/index.phparrival of-jssdk\'));managed toincompletecasualtiescompletionChristiansSeptember arithmeticproceduresmight haveProductionit appearsPhilosophyfriendshipleading togiving thetoward theguaranteeddocumentedcolor:#000video gamecommissionreflectingchange theassociatedsans-serifonkeypress; padding:He was theunderlyingtypically , and the srcElementsuccessivesince the should be networkingaccountinguse of thelower thanshows that</span>\n\t\tcomplaintscontinuousquantitiesastronomerhe did notdue to itsapplied toan averageefforts tothe futureattempt toTherefore,capabilityRepublicanwas formedElectronickilometerschallengespublishingthe formerindigenousdirectionssubsidiaryconspiracydetails ofand in theaffordablesubstancesreason forconventionitemtype=\"absolutelysupposedlyremained aattractivetravellingseparatelyfocuses onelementaryapplicablefound thatstylesheetmanuscriptstands for no-repeat(sometimesCommercialin Americaundertakenquarter ofan examplepersonallyindex.php?</button>\npercentagebest-knowncreating a\" dir=\"ltrLieutenant\n<div id=\"they wouldability ofmade up ofnoted thatclear thatargue thatto anotherchildren\'spurpose offormulatedbased uponthe regionsubject ofpassengerspossession.\n\nIn the Before theafterwardscurrently across thescientificcommunity.capitalismin Germanyright-wingthe systemSociety ofpoliticiandirection:went on toremoval of New York apartmentsindicationduring theunless thehistoricalhad been adefinitiveingredientattendanceCenter forprominencereadyStatestrategiesbut in theas part ofconstituteclaim thatlaboratorycompatiblefailure of, such as began withusing the to providefeature offrom which/\" class=\"geologicalseveral ofdeliberateimportant holds thating" valign=topthe Germanoutside ofnegotiatedhis careerseparationid=\"searchwas calledthe fourthrecreationother thanpreventionwhile the education,connectingaccuratelywere builtwas killedagreementsmuch more Due to thewidth: 100some otherKingdom ofthe entirefamous forto connectobjectivesthe Frenchpeople andfeatured\">is said tostructuralreferendummost oftena separate->\n<div id Official worldwide.aria-labelthe planetand it wasd\" value=\"looking atbeneficialare in themonitoringreportedlythe modernworking onallowed towhere the innovative</a></div>soundtracksearchFormtend to beinput id=\"opening ofrestrictedadopted byaddressingtheologianmethods ofvariant ofChristian very largeautomotiveby far therange frompursuit offollow thebrought toin Englandagree thataccused ofcomes frompreventingdiv style=his or hertremendousfreedom ofconcerning0 1em 1em;Basketball/style.cssan earliereven after/\" title=\".com/indextaking thepittsburghcontent\">\r<script>(fturned outhaving the</span>\r\n occasionalbecause itstarted tophysically></div>\n created byCurrently, bgcolor=\"tabindex=\"disastrousAnalytics also has a><div id=\"</style>\n<called forsinger and.src = \"//violationsthis pointconstantlyis locatedrecordingsd from thenederlandsportuguC*sW\"W\u0011W(W\u0019W*Y\u0001X\'X1X3[\fdesarrollocomentarioeducaciC3nseptiembreregistradodirecciC3nubicaciC3npublicidadrespuestasresultadosimportantereservadosartC-culosdiferentessiguientesrepC:blicasituaciC3nministerioprivacidaddirectorioformaciC3npoblaciC3npresidentecont"
private static final String
"enidosaccesoriostechnoratipersonalescategorC-aespecialesdisponibleactualidadreferenciavalladolidbibliotecarelacionescalendariopolC-ticasanterioresdocumentosnaturalezamaterialesdiferenciaeconC3micatransporterodrC-guezparticiparencuentrandiscusiC3nestructurafundaciC3nfrecuentespermanentetotalmenteP<P>P6P=P>P1Q\u0003P4P5Q\u0002P<P>P6P5Q\u0002P2Q\u0000P5P<Q\u000fQ\u0002P0P:P6P5Q\u0007Q\u0002P>P1Q\u000bP1P>P;P5P5P>Q\u0007P5P=Q\fQ\rQ\u0002P>P3P>P:P>P3P4P0P?P>Q\u0001P;P5P2Q\u0001P5P3P>Q\u0001P0P9Q\u0002P5Q\u0007P5Q\u0000P5P7P<P>P3Q\u0003Q\u0002Q\u0001P0P9Q\u0002P0P6P8P7P=P8P<P5P6P4Q\u0003P1Q\u0003P4Q\u0003Q\u0002P\u001fP>P8Q\u0001P:P7P4P5Q\u0001Q\fP2P8P4P5P>Q\u0001P2Q\u000fP7P8P=Q\u0003P6P=P>Q\u0001P2P>P5P9P;Q\u000eP4P5P9P?P>Q\u0000P=P>P<P=P>P3P>P4P5Q\u0002P5P9Q\u0001P2P>P8Q\u0005P?Q\u0000P0P2P0Q\u0002P0P:P>P9P<P5Q\u0001Q\u0002P>P8P<P5P5Q\u0002P6P8P7P=Q\fP>P4P=P>P9P;Q\u0003Q\u0007Q\bP5P?P5Q\u0000P5P4Q\u0007P0Q\u0001Q\u0002P8Q\u0007P0Q\u0001Q\u0002Q\fQ\u0000P0P1P>Q\u0002P=P>P2Q\u000bQ\u0005P?Q\u0000P0P2P>Q\u0001P>P1P>P9P?P>Q\u0002P>P<P<P5P=P5P5Q\u0007P8Q\u0001P;P5P=P>P2Q\u000bP5Q\u0003Q\u0001P;Q\u0003P3P>P:P>P;P>P=P0P7P0P4Q\u0002P0P:P>P5Q\u0002P>P3P4P0P?P>Q\u0007Q\u0002P8P\u001fP>Q\u0001P;P5Q\u0002P0P:P8P5P=P>P2Q\u000bP9Q\u0001Q\u0002P>P8Q\u0002Q\u0002P0P:P8Q\u0005Q\u0001Q\u0000P0P7Q\u0003P!P0P=P:Q\u0002Q\u0004P>Q\u0000Q\u0003P<P\u001aP>P3P4P0P:P=P8P3P8Q\u0001P;P>P2P0P=P0Q\bP5P9P=P0P9Q\u0002P8Q\u0001P2P>P8P<Q\u0001P2Q\u000fP7Q\fP;Q\u000eP1P>P9Q\u0007P0Q\u0001Q\u0002P>Q\u0001Q\u0000P5P4P8P\u001aQ\u0000P>P<P5P$P>Q\u0000Q\u0003P<Q\u0000Q\u000bP=P:P5Q\u0001Q\u0002P0P;P8P?P>P8Q\u0001P:Q\u0002Q\u000bQ\u0001Q\u000fQ\u0007P<P5Q\u0001Q\u000fQ\u0006Q\u0006P5P=Q\u0002Q\u0000Q\u0002Q\u0000Q\u0003P4P0Q\u0001P0P<Q\u000bQ\u0005Q\u0000Q\u000bP=P:P0P\u001dP>P2Q\u000bP9Q\u0007P0Q\u0001P>P2P<P5Q\u0001Q\u0002P0Q\u0004P8P;Q\fP<P<P0Q\u0000Q\u0002P0Q\u0001Q\u0002Q\u0000P0P=P<P5Q\u0001Q\u0002P5Q\u0002P5P:Q\u0001Q\u0002P=P0Q\bP8Q\u0005P<P8P=Q\u0003Q\u0002P8P<P5P=P8P8P<P5Q\u000eQ\u0002P=P>P<P5Q\u0000P3P>Q\u0000P>P4Q\u0001P0P<P>P<Q\rQ\u0002P>P<Q\u0003P:P>P=Q\u0006P5Q\u0001P2P>P5P<P:P0P:P>P9P\u0010Q\u0000Q\u0005P8P2Y\u0005Y\u0006X*X/Y\tX%X1X3X\'Y\u0004X1X3X\'Y\u0004X)X\'Y\u0004X9X\'Y\u0005Y\u0003X*X(Y\u0007X\'X(X1X\'Y\u0005X,X\'Y\u0004Y\nY\bY\u0005X\'Y\u0004X5Y\bX1X,X/Y\nX/X)X\'Y\u0004X9X6Y\bX%X6X\'Y\u0001X)X\'Y\u0004Y\u0002X3Y\u0005X\'Y\u0004X9X\'X(X*X-Y\u0005Y\nY\u0004Y\u0005Y\u0004Y\u0001X\'X*Y\u0005Y\u0004X*Y\u0002Y\tX*X9X/Y\nY\u0004X\'Y\u0004X4X9X1X#X.X(X\'X1X*X7Y\bY\nX1X9Y\u0004Y\nY\u0003Y\u0005X%X1Y\u0001X\'Y\u0002X7Y\u0004X(X\'X*X\'Y\u0004Y\u0004X:X)X*X1X*Y\nX(X\'Y\u0004Y\u0006X\'X3X\'Y\u0004X4Y\nX.Y\u0005Y\u0006X*X/Y\nX\'Y\u0004X9X1X(X\'Y\u0004Y\u0002X5X5X\'Y\u0001Y\u0004X\'Y\u0005X9Y\u0004Y\nY\u0007X\'X*X-X/Y\nX+X\'Y\u0004Y\u0004Y\u0007Y\u0005X\'Y\u0004X9Y\u0005Y\u0004Y\u0005Y\u0003X*X(X)Y\nY\u0005Y\u0003Y\u0006Y\u0003X\'Y\u0004X7Y\u0001Y\u0004Y\u0001Y\nX/Y\nY\bX%X/X\'X1X)X*X\'X1Y\nX.X\'Y\u0004X5X-X)X*X3X,Y\nY\u0004X\'Y\u0004Y\bY\u0002X*X9Y\u0006X/Y\u0005X\'Y\u0005X/Y\nY\u0006X)X*X5Y\u0005Y\nY\u0005X#X1X4Y\nY\u0001X\'Y\u0004X0Y\nY\u0006X9X1X(Y\nX)X(Y\bX\'X(X)X#Y\u0004X9X\'X(X\'Y\u0004X3Y\u0001X1Y\u0005X4X\'Y\u0003Y\u0004X*X9X\'Y\u0004Y\tX\'Y\u0004X#Y\bY\u0004X\'Y\u0004X3Y\u0006X)X,X\'Y\u0005X9X)X\'Y\u0004X5X-Y\u0001X\'Y\u0004X/Y\nY\u0006Y\u0003Y\u0004Y\u0005X\'X*X\'Y\u0004X.X\'X5X\'Y\u0004Y\u0005Y\u0004Y\u0001X#X9X6X\'X!Y\u0003X*X\'X(X)X\'Y\u0004X.Y\nX1X1X3X\'X&Y\u0004X\'Y\u0004Y\u0002Y\u0004X(X\'Y\u0004X#X/X(Y\u0005Y\u0002X\'X7X9Y\u0005X1X\'X3Y\u0004Y\u0005Y\u0006X7Y\u0002X)X\'Y\u0004Y\u0003X*X(X\'Y\u0004X1X,Y\u0004X\'X4X*X1Y\u0003X\'Y\u0004Y\u0002X/Y\u0005Y\nX9X7Y\nY\u0003sByTagName(.jpg\" alt=\"1px solid #.gif\" alt=\"transparentinformationapplication\" onclick=\"establishedadvertising.png\" alt=\"environmentperformanceappropriate&mdash;immediately</strong></rather thantemperaturedevelopmentcompetitionplaceholdervisibility:copyright\">0\" height=\"even thoughreplacementdestinationCorporation<ul class=\"AssociationindividualsperspectivesetTimeout(url(http://mathematicsmargin-top:eventually description) no-repeatcollections.JPG|thumb|participate/head><bodyfloat:left;<li class=\"hundreds of\n\nHowever, compositionclear:both;cooperationwithin the label for=\"border-top:New Zealandrecommendedphotographyinteresting<sup>controversyNetherlandsalternativemaxlength=\"switzerlandDevelopmentessentially\n\nAlthough </textarea>thunderbirdrepresented&ndash;speculationcommunitieslegislationelectronics\n\t<div id=\"illustratedengineeringterritoriesauthoritiesdistributed6\" height=\"sans-serif;capable of disappearedinteractivelooking forit would beAfghanistanwas createdMath.floor(surroundingcan also beobservationmaintenanceencountered<h2 class=\"more recentit has beeninvasion of).getTime()fundamentalDespite the\"><div id=\"inspirationexaminationpreparationexplanation<input id=\"</a></span>versions ofinstrumentsbefore the = \'http://Descriptionrelatively .substring(each of theexperimentsinfluentialintegrationmany peopledue to the combinationdo not haveMiddle East<noscript><copyright\" perhaps theinstitutionin Decemberarrangementmost famouspersonalitycreation oflimitationsexclusivelysovereignty-content\">\n<td class=\"undergroundparallel todoctrine ofoccupied byterminologyRenaissancea number ofsupport forexplorationrecognitionpredecessor<img src=\"/<h1 class=\"publicationmay also bespecialized</fieldset>progressivemillions ofstates thatenforcementaround the one another.parentNodeagricultureAlternativeresearcherstowards theMost of themany other (especially<td width=\";width:100%independent<h3 class=\" onchange=\").addClass(interactionOne of the daughter ofaccessoriesbranches of\r\n<div id=\"the largestdeclarationregulationsInformationtranslationdocumentaryin order to\">\n<head>\n<\" height=\"1across the orientation);</script>implementedcan be seenthere was ademonstratecontainer\">connectionsthe Britishwas written!important;px; margin-followed byability to complicatedduring the immigrationalso called<h4 class=\"distinctionreplaced bygovernmentslocation ofin Novemberwhether the</p>\n</div>acquisitioncalled the persecutiondesignation{font-size:appeared ininvestigateexperiencedmost likelywidely useddiscussionspresence of (document.extensivelyIt has beenit does notcontrary toinhabitantsimprovementscholarshipconsumptioninstructionfor exampleone or morepx; paddingthe currenta series ofare usuallyrole in thepreviously derivativesevidence ofexperiencescolorschemestated thatcertificate</a></div>\n selected=\"high schoolresponse tocomfortableadoption ofthree yearsthe countryin Februaryso that thepeople who provided by<param nameaffected byin terms ofappointmentISO-8859-1\"was born inhistorical regarded asmeasurementis based on and other : function(significantcelebrationtransmitted/js/jquery.is known astheoretical tabindex=\"it could be<noscript>\nhaving been\r\n<head>\r\n< "The compilationhe had beenproduced byphilosopherconstructedintended toamong othercompared toto say thatEngineeringa differentreferred todifferencesbelief thatphotographsidentifyingHistory of Republic ofnecessarilyprobabilitytechnicallyleaving thespectacularfraction ofelectricityhead of therestaurantspartnershipemphasis onmost recentshare with saying thatfilled withdesigned toit is often\"></iframe>as follows:merged withthrough thecommercial pointed outopportunityview of therequirementdivision ofprogramminghe receivedsetInterval\"></span></in New Yorkadditional compression\n\n<div id=\"incorporate;</script><attachEventbecame the \" target=\"_carried outSome of thescience andthe time ofContainer\">maintainingChristopherMuch of thewritings of\" height=\"2size of theversion of mixture of between theExamples ofeducationalcompetitive onsubmit=\"director ofdistinctive/DTD XHTML relating totendency toprovince ofwhich woulddespite thescientific legislature.innerHTML allegationsAgriculturewas used inapproach tointelligentyears later,sans-serifdeterminingPerformanceappearances, which is foundationsabbreviatedhigher thans from the individual composed ofsupposed toclaims thatattributionfont-size:1elements ofHistorical his brotherat the timeanniversarygoverned byrelated to ultimately innovationsit is stillcan only bedefinitionstoGMTStringA number ofimg class=\"Eventually,was changedoccurred inneighboringdistinguishwhen he wasintroducingterrestrialMany of theargues thatan Americanconquest ofwidespread were killedscreen and In order toexpected todescendantsare locatedlegislativegenerations backgroundmost peopleyears afterthere is nothe highestfrequently they do notargued thatshowed thatpredominanttheologicalby the timeconsideringshort-lived</span></a>can be usedvery littleone of the had alreadyinterpretedcommunicatefeatures ofgovernment,</noscript>entered the\" height=\"3Independentpopulationslarge-scale. Although used in thedestructionpossibilitystarting intwo or moreexpressionssubordinatelarger thanhistory and</option>\r\nContinentaleliminatingwill not bepractice ofin front ofsite of theensure thatto create amississippipotentiallyoutstandingbetter thanwhat is nowsituated inmeta name=\"TraditionalsuggestionsTranslationthe form ofatmosphericideologicalenterprisescalculatingeast of theremnants ofpluginspage/index.php?remained intransformedHe was alsowas alreadystatisticalin favor ofMinistry ofmovement offormulationis required<link rel=\"This is the <a href=\"/popularizedinvolved inare used toand severalmade by theseems to belikely thatPalestiniannamed afterit had beenmost commonto refer tobut this isconsecutivetemporarilyIn general,conventionstakes placesubdivisionterritorialoperationalpermanentlywas largelyoutbreak ofin the pastfollowing a xmlns:og=\"><a class=\"class=\"textConversion may be usedmanufactureafter beingclearfix\">\nquestion ofwas electedto become abecause of some peopleinspired bysuccessful a time whenmore commonamongst thean officialwidth:100%;technology,was adoptedto keep thesettlementslive birthsindex.html\"Connecticutassigned to&times;account foralign=rightthe companyalways beenreturned toinvolvementBecause thethis period\" name=\"q\" confined toa result ofvalue=\"\" />is actuallyEnvironment\r\n</head>\r\nConversely,>\n<div id=\"0\" width=\"1is probablyhave becomecontrollingthe problemcitizens ofpoliticiansreached theas early as:none; over<table cellvalidity ofdirectly toonmousedownwhere it iswhen it wasmembers of relation toaccommodatealong with In the latethe Englishdelicious\">this is notthe presentif they areand finallya matter of\r\n\t</div>\r\n\r\n</script>faster thanmajority ofafter whichcomparativeto maintainimprove theawarded theer\" class=\"frameborderrestorationin the sameanalysis oftheir firstDuring the continentalsequence offunction(){font-size: work on the</script>\n<begins withjavascript:constituentwas foundedequilibriumassume thatis given byneeds to becoordinatesthe variousare part ofonly in thesections ofis a commontheories ofdiscoveriesassociationedge of thestrength ofposition inpresent-dayuniversallyto form thebut insteadcorporationattached tois commonlyreasons for "the can be madewas able towhich meansbut did notonMouseOveras possibleoperated bycoming fromthe primaryaddition offor severaltransferreda period ofare able tohowever, itshould havemuch larger\n\t</script>adopted theproperty ofdirected byeffectivelywas broughtchildren ofProgramminglonger thanmanuscriptswar againstby means ofand most ofsimilar to proprietaryoriginatingprestigiousgrammaticalexperience.to make theIt was alsois found incompetitorsin the U.S.replace thebrought thecalculationfall of thethe generalpracticallyin honor ofreleased inresidentialand some ofking of thereaction to1st Earl ofculture andprincipally</title>\n they can beback to thesome of hisexposure toare similarform of theaddFavoritecitizenshippart in thepeople within practiceto continue&minus;approved by the first allowed theand for thefunctioningplaying thesolution toheight=\"0\" in his bookmore than afollows thecreated thepresence in </td>nationalistthe idea ofa characterwere forced class=\"btndays of thefeatured inshowing theinterest inin place ofturn of thethe head ofLord of thepoliticallyhas its ownEducationalapproval ofsome of theeach other,behavior ofand becauseand anotherappeared onrecorded inblack"may includethe world\'scan lead torefers to aborder=\"0\" government winning theresulted in while the Washington,the subjectcity in the></div>\r\n\t\treflect theto completebecame moreradioactiverejected bywithout anyhis father,which couldcopy of theto indicatea politicalaccounts ofconstitutesworked wither</a></li>of his lifeaccompaniedclientWidthprevent theLegislativedifferentlytogether inhas severalfor anothertext of thefounded thee with the is used forchanged theusually theplace wherewhereas the> <a href=\"\"><a href=\"themselves,although hethat can betraditionalrole of theas a resultremoveChilddesigned bywest of theSome peopleproduction,side of thenewslettersused by thedown to theaccepted bylive in theattempts tooutside thefrequenciesHowever, inprogrammersat least inapproximatealthough itwas part ofand variousGovernor ofthe articleturned into><a href=\"/the economyis the mostmost widelywould laterand perhapsrise to theoccurs whenunder whichconditions.the westerntheory thatis producedthe city ofin which heseen in thethe centralbuilding ofmany of hisarea of theis the onlymost of themany of thethe WesternThere is noextended toStatisticalcolspan=2 |short storypossible totopologicalcritical ofreported toa Christiandecision tois equal toproblems ofThis can bemerchandisefor most ofno evidenceeditions ofelements in". Thecom/images/which makesthe processremains theliterature,is a memberthe popularthe ancientproblems intime of thedefeated bybody of thea few yearsmuch of thethe work ofCalifornia,served as agovernment.concepts ofmovement in\t\t<div id=\"it\" value=\"language ofas they areproduced inis that theexplain thediv></div>\nHowever thelead to the\t<a href=\"/was grantedpeople havecontinuallywas seen asand relatedthe role ofproposed byof the besteach other.Constantinepeople fromdialects ofto revisionwas renameda source ofthe initiallaunched inprovide theto the westwhere thereand similarbetween twois also theEnglish andconditions,that it wasentitled tothemselves.quantity ofransparencythe same asto join thecountry andthis is theThis led toa statementcontrast tolastIndexOfthrough hisis designedthe term isis providedprotect theng</a></li>The currentthe site ofsubstantialexperience,in the Westthey shouldslovenD\rinacomentariosuniversidadcondicionesactividadesexperienciatecnologC-aproducciC3npuntuaciC3naplicaciC3ncontraseC1acategorC-asregistrarseprofesionaltratamientoregC-stratesecretarC-aprincipalesprotecciC3nimportantesimportanciaposibilidadinteresantecrecimientonecesidadessuscribirseasociaciC3ndisponiblesevaluaciC3nestudiantesresponsableresoluciC3nguadalajararegistradosoportunidadcomercialesfotografC-aautoridadesingenierC-atelevisiC3ncompetenciaoperacionesestablecidosimplementeactualmentenavegaciC3nconformidadline-height:font-family:\" : \"http://applicationslink\" href=\"specifically//<![CDATA[\nOrganizationdistribution0px; height:relationshipdevice-width<div class=\"<label for=\"registration</noscript>\n/index.html\"window.open( !important;application/independence//www.googleorganizationautocompleterequirementsconservative<form name=\"intellectualmargin-left:18th centuryan importantinstitutionsabbreviation<img class=\"organisationcivilization19th centuryarchitectureincorporated20th century-container\">most notably/></a></div>notification\'undefined\')Furthermore,believe thatinnerHTML = prior to thedramaticallyreferring tonegotiationsheadquartersSouth AfricaunsuccessfulPennsylvaniaAs a result,<html lang=\"</sup>dealing withphiladelphiahistorically);</script>\npadding-top:experimentalgetAttributeinstructionstechnologiespart of the =function(){subscriptionl.dtd\">\r\n<htgeographicalConstitution\', function(supported byagriculturalconstructionpublicationsfont-size: 1a variety of<div style=\"Encyclopediaiframe src=\"demonstratedaccomplisheduniversitiesDemographics);</script><dedicated toknowledge ofsatisfactionparticularly</div></div>English (US)appendChild(transmissions. However, intelligence\" tabindex=\"float:right;Commonwealthranging fromin which theat least onereproductionencyclopedia;font-size:1jurisdictionat that time\"><a class=\"In addition,description+conversationcontact withis generallyr\" content=\"representing<math>presentationoccasionally<img width=\"navigation\">compensationchampionshipmedia=\"all\" violation ofreference toreturn true;Strict//EN\" transactionsinterventionverificationInformation difficultiesChampionshipcapabilities<![endif]-->}\n</script>\nChristianityfor example,Professionalrestrictionssuggest thatwas released(such as theremoveClass(unemploymentthe Americanstructure of/index.html published inspan class=\"\"><a href=\"/introductionbelonging toclaimed thatconsequences<meta name=\"Guide to theoverwhelmingagainst the concentrated,\n.nontouch observations</a>\n</div>\nf (document.border: 1px {font-size:1treatment of0\" height=\"1modificationIndependencedivided intogreater thanachievementsestablishingJavaScript\" neverthelesssignificanceBroadcasting> </td>container\">\nsuch as the influence ofa particularsrc=\'http://navigation\" half of the substantial </div>advantage ofdiscovery offundamental metropolitanthe opposite\" xml:lang=\"deliberatelyalign=centerevolution ofpreservationimprovementsbeginning inJesus ChristPublicationsdisagreementtext-align:r, function()similaritiesbody></html>is currentlyalphabeticalis sometimestype=\"image/many of the flow:hidden;available indescribe theexistence ofall over thethe Internet\t<ul class=\"installationneighborhoodarmed forcesreducing thecontinues toNonetheless,temperatures\n\t\t<a href=\"close to theexamples of is about the(see below).\" id=\"searchprofessionalis availablethe official\t\t</script>\n\n\t\t<div id=\"accelerationthrough the Hall of Famedescriptionstranslationsinterference type=\'text/recent yearsin the worldvery popular{background:traditional some of the connected toexploitationemergence ofconstitutionA History ofsignificant manufacturedexpectations><noscript><can be foundbecause the has not beenneighbouringwithout the added to the\t<li class=\"instrumentalSoviet Unionacknowledgedwhich can bename for theattention toattempts to developmentsIn fact, the<li class=\"aimplicationssuitable formuch of the colonizationpresidentialcancelBubble Informationmost of the is describedrest of the more or lessin SeptemberIntelligencesrc=\"http://px; height: available tomanufacturerhuman rightslink href=\"/availabilityproportionaloutside the astronomicalhuman beingsname of the are found inare based onsmaller thana person whoexpansion ofarguing thatnow known asIn the earlyintermediatederived fromScandinavian</a></div>\r\nconsider thean estimatedthe National<div id=\"pagresulting incommissionedanalogous toare required/ul>\n</div>\nwas based onand became a t\" value=\"\" was capturedno more thanrespectivelycontinue to >\r\n<head>\r\n<were createdmore generalinformation used for theindependent the Imperialcomponent ofto the northinclude the Constructionside of the would not befor instanceinvention ofmore complexcollectivelybackground: text-align: its originalinto accountthis processan extensivehowever, thethey are notrejected thecriticism ofduring whichprobably thethis article(function(){It should bean agreementaccidentallydiffers fromArchitecturebetter knownarrangementsinfluence onattended theidentical tosouth of thepass throughxml\" title=\"weight:bold;creating thedisplay:nonereplaced the<img src=\"/ihttps://www.World War IItestimonialsfound in therequired to and that thebetween the was designedconsists of considerablypublished bythe languageConservationconsisted ofrefer to theback to the css\" media=\"People from available onproved to besuggestions\"was known asvarieties oflikely to becomprised ofsupport the hands of thecoupled withconnect and border:none;performancesbefore beinglater becamecalculationsoften calledresidents ofmeaning that><li class=\"evidence forexplanationsenvironments\"></a></div>which allowsIntroductiondeveloped bya wide rangeon behalf ofvalign=\"top\"principle ofat the time,</noscript>\rsaid to havein the firstwhile othershypotheticalphilosopherspower of thecontained inperformed byinability towere writtenspan style=\"input name=\"the questionintended forrejection ofimplies thatinvented thethe standardwas probablylink betweenprofessor ofinteractionschanging theIndian Ocean class=\"lastworking with\'http://www.years beforeThis was therecreationalentering themeasurementsan extremelyvalue of thestart of the\n</script>\n\nan effort toincrease theto the southspacing=\"0\">sufficientlythe Europeanconverted toclearTimeoutdid not haveconsequentlyfor the nextextension ofeconomic andalthough theare producedand with theinsufficientgiven by thestating thatexpenditures</span></a>\nthought thaton the basiscellpadding=image of thereturning toinformation,separated byassassinateds\" content=\"authority ofnorthwestern</div>\n<div \"></div>\r\n consultationcommunity ofthe nationalit should beparticipants align=\"leftthe greatestselection ofsupernaturaldependent onis mentionedallowing thewas inventedaccompanyinghis personalavailable atstudy of theon the otherexecution ofHuman Rightsterms of theassociationsresearch andsucceeded bydefeated theand from thebut they arecommander ofstate of theyears of agethe study of<ul class=\"splace in thewhere he was<li class=\"fthere are nowhich becamehe publishedexpressed into which thecommissionerfont-weight:territory ofextensions\">Roman Empireequal to theIn contrast,however, andis typicallyand his wife(also called><ul class=\"effectively evolved intoseem to havewhich is thethere was noan excellentall of thesedescribed byIn practice,broadcastingcharged withreflected insubjected tomilitary andto the pointeconomicallysetTargetingare actuallyvictory over();</script>continuouslyrequired forevolutionaryan effectivenorth of the, which was front of theor otherwisesome form ofhad not beengenerated byinformation.permitted toincludes thedevelopment,entered intothe previousconsistentlyare known asthe field ofthis type ofgiven to thethe title ofcontains theinstances ofin the northdue to theirare designedcorporationswas that theone of thesemore popularsucceeded insupport fromin differentdominated bydesigned forownership ofand possiblystandardizedresponseTextwas intendedreceived theassumed thatareas of theprimarily inthe basis ofin the senseaccounts fordestroyed byat least twowas declaredcould not beSecretary ofappear to bemargin-top:1/^\\s+|\\s+$/ge){throw e};the start oftwo separatelanguage andwho had beenoperation ofdeath of thereal numbers\t<link rel=\"provided thethe story ofcompetitionsenglish (UK)english (US)P\u001cP>P=P3P>P;P!Q\u0000P?Q\u0001P:P8Q\u0001Q\u0000P?Q\u0001P:P8Q\u0001Q\u0000P?Q\u0001P:P>Y\u0004X9X1X(Y\nX)f-#i+\u0014d8-f\u0016\u0007g.\u0000d=\u0013d8-f\u0016\u0007g9\u0001d=\u0013d8-f\u0016\u0007f\u001c\ti\u0019\u0010e\u0005,e\u000f8d::f0\u0011f\u0014?e:\u001ci\u0018?i\u0007\fe74e74g$>d<\u001ad8;d9\tf\u0013\rd=\u001cg3;g;\u001ff\u0014?g-\u0016f3\u0015h\'\u0004informaciC3nherramientaselectrC3nicodescripciC3nclasificadosconocimientopublicaciC3nrelacionadasinformC!ticarelacionadosdepartamentotrabajadoresdirectamenteayuntamientomercadoLibrecontC!ctenoshabitacionescumplimientorestaurantesdisposiciC3nconsecuenciaelectrC3nicaaplicacionesdesconectadoinstalaciC3nrealizaciC3nutilizaciC3nenciclopediaenfermedadesinstrumentosexperienciasinstituciC3nparticularessubcategoriaQ\u0002P>P;Q\fP:P>P P>Q\u0001Q\u0001P8P8Q\u0000P0P1P>Q\u0002Q\u000bP1P>P;Q\fQ\bP5P?Q\u0000P>Q\u0001Q\u0002P>P<P>P6P5Q\u0002P5P4Q\u0000Q\u0003P3P8Q\u0005Q\u0001P;Q\u0003Q\u0007P0P5Q\u0001P5P9Q\u0007P0Q\u0001P2Q\u0001P5P3P4P0P P>Q\u0001Q\u0001P8Q\u000fP\u001cP>Q\u0001P:P2P5P4Q\u0000Q\u0003P3P8P5P3P>Q\u0000P>P4P0P2P>P?Q\u0000P>Q\u0001P4P0P=P=Q\u000bQ\u0005P4P>P;P6P=Q\u000bP8P<P5P=P=P>P\u001cP>Q\u0001P:P2Q\u000bQ\u0000Q\u0003P1P;P5P9P\u001cP>Q\u0001P:P2P0Q\u0001Q\u0002Q\u0000P0P=Q\u000bP=P8Q\u0007P5P3P>Q\u0000P0P1P>Q\u0002P5P4P>P;P6P5P=Q\u0003Q\u0001P;Q\u0003P3P8Q\u0002P5P?P5Q\u0000Q\fP\u001eP4P=P0P:P>P?P>Q\u0002P>P<Q\u0003Q\u0000P0P1P>Q\u0002Q\u0003P0P?Q\u0000P5P;Q\u000fP2P>P>P1Q\tP5P>P4P=P>P3P>Q\u0001P2P>P5P3P>Q\u0001Q\u0002P0Q\u0002Q\fP8P4Q\u0000Q\u0003P3P>P9Q\u0004P>Q\u0000Q\u0003P<P5Q\u0005P>Q\u0000P>Q\bP>P?Q\u0000P>Q\u0002P8P2Q\u0001Q\u0001Q\u000bP;P:P0P:P0P6P4Q\u000bP9P2P;P0Q\u0001Q\u0002P8P3Q\u0000Q\u0003P?P?Q\u000bP2P<P5Q\u0001Q\u0002P5Q\u0000P0P1P>Q\u0002P0Q\u0001P:P0P7P0P;P?P5Q\u0000P2Q\u000bP9P4P5P;P0Q\u0002Q\fP4P5P=Q\fP3P8P?P5Q\u0000P8P>P4P1P8P7P=P5Q\u0001P>Q\u0001P=P>P2P5P<P>P<P5P=Q\u0002P:Q\u0003P?P8Q\u0002Q\fP4P>P;P6P=P0Q\u0000P0P<P:P0Q\u0005P=P0Q\u0007P0P;P>P P0P1P>Q\u0002P0P\"P>P;Q\fP:P>Q\u0001P>P2Q\u0001P5P<P2Q\u0002P>Q\u0000P>P9P=P0Q\u0007P0P;P0Q\u0001P?P8Q\u0001P>P:Q\u0001P;Q\u0003P6P1Q\u000bQ\u0001P8Q\u0001Q\u0002P5P<P?P5Q\u0007P0Q\u0002P8P=P>P2P>P3P>P?P>P<P>Q\tP8Q\u0001P0P9Q\u0002P>P2P?P>Q\u0007P5P<Q\u0003P?P>P<P>Q\tQ\fP4P>P;P6P=P>Q\u0001Q\u0001Q\u000bP;P:P8P1Q\u000bQ\u0001Q\u0002Q\u0000P>P4P0P=P=Q\u000bP5P<P=P>P3P8P5P?Q\u0000P>P5P:Q\u0002P!P5P9Q\u0007P0Q\u0001P<P>P4P5P;P8Q\u0002P0P:P>P3P>P>P=P;P0P9P=P3P>Q\u0000P>P4P5P2P5Q\u0000Q\u0001P8Q\u000fQ\u0001Q\u0002Q\u0000P0P=P5Q\u0004P8P;Q\fP<Q\u000bQ\u0003Q\u0000P>P2P=Q\u000fQ\u0000P0P7P=Q\u000bQ\u0005P8Q\u0001P:P0Q\u0002Q\fP=P5P4P5P;Q\u000eQ\u000fP=P2P0Q\u0000Q\u000fP<P5P=Q\fQ\bP5P<P=P>P3P8Q\u0005P4P0P=P=P>P9P7P=P0Q\u0007P8Q\u0002P=P5P;Q\fP7Q\u000fQ\u0004P>Q\u0000Q\u0003P<P0P\"P5P?P5Q\u0000Q\fP<P5Q\u0001Q\u000fQ\u0006P0P7P0Q\tP8Q\u0002Q\u000bP\u001bQ\u0003Q\u0007Q\bP8P5`$(`$9`%\u0000`$\u0002`$\u0015`$0`$(`%\u0007`$\u0005`$*`$(`%\u0007`$\u0015`$?`$/`$>`$\u0015`$0`%\u0007`$\u0002`$\u0005`$(`%\r`$/`$\u0015`%\r`$/`$>`$\u0017`$>`$\u0007`$!`$,`$>`$0`%\u0007`$\u0015`$?`$8`%\u0000`$&`$?`$/`$>`$*`$9`$2`%\u0007`$8`$?`$\u0002`$9`$-`$>`$0`$$`$\u0005`$*`$(`%\u0000`$5`$>`$2`%\u0007`$8`%\u0007`$5`$>`$\u0015`$0`$$`%\u0007`$.`%\u0007`$0`%\u0007`$9`%\u000b`$(`%\u0007`$8`$\u0015`$$`%\u0007`$,`$9`%\u0001`$$`$8`$>`$\u0007`$\u001f`$9`%\u000b`$\u0017`$>`$\u001c`$>`$(`%\u0007`$.`$?`$(`$\u001f`$\u0015`$0`$$`$>`$\u0015`$0`$(`$>`$\t`$(`$\u0015`%\u0007`$/`$9`$>`$\u0001`$8`$,`$8`%\u0007`$-`$>`$7`$>`$\u0006`$*`$\u0015`%\u0007`$2`$?`$/`%\u0007`$6`%\u0001`$0`%\u0002`$\u0007`$8`$\u0015`%\u0007`$\u0018`$\u0002`$\u001f`%\u0007`$.`%\u0007`$0`%\u0000`$8`$\u0015`$$`$>`$.`%\u0007`$0`$>`$2`%\u0007`$\u0015`$0`$\u0005`$\'`$?`$\u0015`$\u0005`$*`$(`$>`$8`$.`$>`$\u001c`$.`%\u0001`$\u001d`%\u0007`$\u0015`$>`$0`$#`$9`%\u000b`$$`$>`$\u0015`$!`$<`%\u0000`$/`$9`$>`$\u0002`$9`%\u000b`$\u001f`$2`$6`$,`%\r`$&`$2`$?`$/`$>`$\u001c`%\u0000`$5`$(`$\u001c`$>`$$`$>`$\u0015`%\b`$8`%\u0007`$\u0006`$*`$\u0015`$>`$5`$>`$2`%\u0000`$&`%\u0007`$(`%\u0007`$*`%\u0002`$0`%\u0000`$*`$>`$(`%\u0000`$\t`$8`$\u0015`%\u0007`$9`%\u000b`$\u0017`%\u0000`$,`%\b`$ `$\u0015`$\u0006`$*`$\u0015`%\u0000`$5`$0`%\r`$7`$\u0017`$>`$\u0002`$5`$\u0006`$*`$\u0015`%\u000b`$\u001c`$?`$2`$>`$\u001c`$>`$(`$>`$8`$9`$.`$$`$9`$.`%\u0007`$\u0002`$\t`$(`$\u0015`%\u0000`$/`$>`$9`%\u0002`$&`$0`%\r`$\u001c`$8`%\u0002`$\u001a`%\u0000`$*`$8`$\u0002`$&`$8`$5`$>`$2`$9`%\u000b`$(`$>`$9`%\u000b`$$`%\u0000`$\u001c`%\b`$8`%\u0007`$5`$>`$*`$8`$\u001c`$(`$$`$>`$(`%\u0007`$$`$>`$\u001c`$>`$0`%\u0000`$\u0018`$>`$/`$2`$\u001c`$?`$2`%\u0007`$(`%\u0000`$\u001a`%\u0007`$\u001c`$>`$\u0002`$\u001a`$*`$$`%\r`$0`$\u0017`%\u0002`$\u0017`$2`$\u001c`$>`$$`%\u0007`$,`$>`$9`$0`$\u0006`$*`$(`%\u0007`$5`$>`$9`$(`$\u0007`$8`$\u0015`$>`$8`%\u0001`$,`$9`$0`$9`$(`%\u0007`$\u0007`$8`$8`%\u0007`$8`$9`$?`$$`$,`$!`$<`%\u0007`$\u0018`$\u001f`$(`$>`$$`$2`$>`$6`$*`$>`$\u0002`$\u001a`$6`%\r`$0`%\u0000`$,`$!`$<`%\u0000`$9`%\u000b`$$`%\u0007`$8`$>`$\b`$\u001f`$6`$>`$/`$&`$8`$\u0015`$$`%\u0000`$\u001c`$>`$$`%\u0000`$5`$>`$2`$>`$9`$\u001c`$>`$0`$*`$\u001f`$(`$>`$0`$\u0016`$(`%\u0007`$8`$!`$<`$\u0015`$.`$?`$2`$>`$\t`$8`$\u0015`%\u0000`$\u0015`%\u0007`$5`$2`$2`$\u0017`$$`$>`$\u0016`$>`$(`$>`$\u0005`$0`%\r`$%`$\u001c`$9`$>`$\u0002`$&`%\u0007`$\u0016`$>`$*`$9`$2`%\u0000`$(`$?`$/`$.`$,`$?`$(`$>`$,`%\b`$\u0002`$\u0015`$\u0015`$9`%\u0000`$\u0002`$\u0015`$9`$(`$>`$&`%\u0007`$$`$>`$9`$.`$2`%\u0007`$\u0015`$>`$+`%\u0000`$\u001c`$,`$\u0015`$?`$$`%\u0001`$0`$$`$.`$>`$\u0002`$\u0017`$5`$9`%\u0000`$\u0002`$0`%\u000b`$\u001c`$<`$.`$?`$2`%\u0000`$\u0006`$0`%\u000b`$*`$8`%\u0007`$(`$>`$/`$>`$&`$5`$2`%\u0007`$(`%\u0007`$\u0016`$>`$$`$>`$\u0015`$0`%\u0000`$,`$\t`$(`$\u0015`$>`$\u001c`$5`$>`$,`$*`%\u0002`$0`$>`$,`$!`$<`$>`$8`%\f`$&`$>`$6`%\u0007`$/`$0`$\u0015`$?`$/`%\u0007`$\u0015`$9`$>`$\u0002`$\u0005`$\u0015`$8`$0`$,`$(`$>`$\u000f`$5`$9`$>`$\u0002`$8`%\r`$%`$2`$.`$?`$2`%\u0007`$2`%\u0007`$\u0016`$\u0015`$5`$?`$7`$/`$\u0015`%\r`$0`$\u0002`$8`$.`%\u0002`$9`$%`$>`$(`$>X*X3X*X7Y\nX9Y\u0005X4X\'X1Y\u0003X)X(Y\bX\'X3X7X)X\'Y\u0004X5Y\u0001X-X)Y\u0005Y\bX\'X6Y\nX9X\'Y\u0004X.X\'X5X)X\'Y\u0004Y\u0005X2Y\nX/X\'Y\u0004X9X\'Y\u0005X)X\'Y\u0004Y\u0003X\'X*X(X\'Y\u0004X1X/Y\bX/X(X1Y\u0006X\'Y\u0005X,X\'Y\u0004X/Y\bY\u0004X)X\'Y\u0004X9X\'Y\u0004Y\u0005X\'Y\u0004Y\u0005Y\bY\u0002X9X\'Y\u0004X9X1X(Y\nX\'Y\u0004X3X1Y\nX9X\'Y\u0004X,Y\bX\'Y\u0004X\'Y\u0004X0Y\u0007X\'X(X\'Y\u0004X-Y\nX\'X)X\'Y\u0004X-Y\u0002Y\bY\u0002X\'Y\u0004Y\u0003X1Y\nY\u0005X\'Y\u0004X9X1X\'Y\u0002Y\u0005X-Y\u0001Y\bX8X)X\'Y\u0004X+X\'Y\u0006Y\nY\u0005X4X\'Y\u0007X/X)X\'Y\u0004Y\u0005X1X#X)X\'Y\u0004Y\u0002X1X\"Y\u0006X\'Y\u0004X4X(X\'X(X\'Y\u0004X-Y\bX\'X1X\'Y\u0004X,X/Y\nX/X\'Y\u0004X#X3X1X)X\'Y\u0004X9Y\u0004Y\bY\u0005Y\u0005X,Y\u0005Y\bX9X)X\'Y\u0004X1X-Y\u0005Y\u0006X\'Y\u0004Y\u0006Y\u0002X\'X7Y\u0001Y\u0004X3X7Y\nY\u0006X\'Y\u0004Y\u0003Y\bY\nX*X\'Y\u0004X/Y\u0006Y\nX\'X(X1Y\u0003X\'X*Y\u0007X\'Y\u0004X1Y\nX\'X6X*X-Y\nX\'X*Y\nX(X*Y\bY\u0002Y\nX*X\'Y\u0004X#Y\bY\u0004Y\tX\'Y\u0004X(X1Y\nX/X\'Y\u0004Y\u0003Y\u0004X\'Y\u0005X\'Y\u0004X1X\'X(X7X\'Y\u0004X4X.X5Y\nX3Y\nX\'X1X\'X*X\'Y\u0004X+X\'Y\u0004X+X\'Y\u0004X5Y\u0004X\'X)X\'Y\u0004X-X/Y\nX+X\'Y\u0004X2Y\bX\'X1X\'Y\u0004X.Y\u0004Y\nX,X\'Y\u0004X,Y\u0005Y\nX9X\'Y\u0004X9X\'Y\u0005Y\u0007X\'Y\u0004X,Y\u0005X\'Y\u0004X\'Y\u0004X3X\'X9X)Y\u0005X4X\'Y\u0007X/Y\u0007X\'Y\u0004X1X&Y\nX3X\'Y\u0004X/X.Y\bY\u0004X\'Y\u0004Y\u0001Y\u0006Y\nX)X\'Y\u0004Y\u0003X*X\'X(X\'Y\u0004X/Y\bX1Y\nX\'Y\u0004X/X1Y\bX3X\'X3X*X:X1Y\u0002X*X5X\'Y\u0005Y\nY\u0005X\'Y\u0004X(Y\u0006X\'X*X\'Y\u0004X9X8Y\nY\u0005entertainmentunderstanding = function().jpg\" width=\"configuration.png\" width=\"<body class=\"Math.random()contemporary United Statescircumstances.appendChild(organizations<span class=\"\"><img src=\"/distinguishedthousands of communicationclear\"></div>investigationfavicon.ico\" margin-right:based on the Massachusettstable border=internationalalso known aspronunciationbackground:#fpadding-left:For example, miscellaneous</math>psychologicalin particularearch\" type=\"form method=\"as opposed toSupreme Courtoccasionally Additionally,North Americapx;backgroundopportunitiesEntertainment.toLowerCase(manufacturingprofessional combined withFor instance,consisting of\" maxlength=\"return false;consciousnessMediterraneanextraordinaryassassinationsubsequently button type=\"the number ofthe original comprehensiverefers to the</ul>\n</div>\nphilosophicallocation.hrefwas publishedSan Francisco(function(){\n<div id=\"mainsophisticatedmathematical /head>\r\n<bodysuggests thatdocumentationconcentrationrelationshipsmay have been(for example,This article in some casesparts of the definition ofGreat Britain cellpadding=equivalent toplaceholder=\"; font-size: justificationbelieved thatsuffered fromattempted to leader of thecript\" src=\"/(function() {are available\n\t<link rel=\" src=\'http://interested inconventional \" alt=\"\" /></are generallyhas also beenmost popular correspondingcredited withtyle=\"border:</a></span></.gif\" width=\"<iframe src=\"table class=\"inline-block;according to together withapproximatelyparliamentarymore and moredisplay:none;traditionallypredominantly | </span> cellspacing=<input name=\"or\" content=\"controversialproperty=\"og:/x-shockwave-demonstrationsurrounded byNevertheless,was the firstconsiderable Although the collaborationshould not beproportion of<span style=\"known as the shortly afterfor instance,described as /head>\n<body starting withincreasingly the fact thatdiscussion ofmiddle of thean individualdifficult to point of viewhomosexualityacceptance of</span></div>manufacturersorigin of thecommonly usedimportance ofdenominationsbackground: #length of thedeterminationa significant\" border=\"0\">revolutionaryprinciples ofis consideredwas developedIndo-Europeanvulnerable toproponents ofare sometimescloser to theNew York City name=\"searchattributed tocourse of themathematicianby the end ofat the end of\" border=\"0\" technological.removeClass(branch of theevidence that![endif]-->\r\nInstitute of into a singlerespectively.and thereforeproperties ofis located insome of whichThere is alsocontinued to appearance of &ndash; describes theconsiderationauthor of theindependentlyequipped withdoes not have</a><a href=\"confused with<link href=\"/at the age ofappear in theThese includeregardless ofcould be used style="several timesrepresent thebody>\n</html>thought to bepopulation ofpossibilitiespercentage ofaccess to thean attempt toproduction ofjquery/jquerytwo differentbelong to theestablishmentreplacing thedescription\" determine theavailable forAccording to wide range of\t<div class=\"more commonlyorganisationsfunctionalitywas completed &mdash; participationthe characteran additionalappears to befact that thean example ofsignificantlyonmouseover=\"because they async = true;problems withseems to havethe result of src=\"http://familiar withpossession offunction () {took place inand sometimessubstantially<span></span>is often usedin an attemptgreat deal ofEnvironmentalsuccessfully virtually all20th century,professionalsnecessary to determined bycompatibilitybecause it isDictionary ofmodificationsThe followingmay refer to:Consequently,Internationalalthough somethat would beworld\'s firstclassified asbottom of the(particularlyalign=\"left\" most commonlybasis for thefoundation ofcontributionspopularity ofcenter of theto reduce thejurisdictionsapproximation onmouseout=\"New Testamentcollection of</span></a></in the Unitedfilm director-strict.dtd\">has been usedreturn to thealthough thischange in theseveral otherbut there areunprecedentedis similar toespecially inweight: bold;is called thecomputationalindicate thatrestricted to\t<meta name=\"are typicallyconflict withHowever, the An example ofcompared withquantities ofrather than aconstellationnecessary forreported thatspecificationpolitical and <references tothe same yearGovernment ofgeneration ofhave not beenseveral yearscommitment to\t\t<ul class=\"visualization19th century,practitionersthat he wouldand continuedoccupation ofis defined ascentre of thethe amount of><div style=\"equivalent ofdifferentiatebrought aboutmargin-left: automaticallythought of asSome of these\n<div class=\"input class=\"replaced withis one of theeducation andinfluenced byreputation as\n<meta name=\"accommodation</div>\n</div>large part ofInstitute forthe so-called against the In this case,was appointedclaimed to beHowever, thisDepartment ofthe remainingeffect on theparticularly deal with the\n<div style=\"almost alwaysare currentlyexpression ofphilosophy offor more thancivilizationson the islandselectedIndexcan result in\" value=\"\" />the structure /></a></div>Many of thesecaused by theof the Unitedspan class=\"mcan be tracedis related tobecame one ofis frequentlyliving in thetheoreticallyFollowing theRevolutionarygovernment inis determinedthe politicalintroduced insufficient todescription\">short storiesseparation ofas to whetherknown for itswas initiallydisplay:blockis an examplethe principalconsists of arecognized as/body></html>a substantialreconstructedhead of stateresistance toundergraduateThere are twogravitationalare describedintentionallyserved as theclass=\"headeropposition tofundamentallydominated theand the otheralliance withwas forced torespectively,and politicalin support ofpeople in the20th century.and publishedloadChartbeatto understandmember statesenvironmentalfirst half ofcountries andarchitecturalbe consideredcharacterizedclearIntervalauthoritativeFederation ofwas succeededand there area consequencethe Presidentalso includedfree softwaresuccession ofdeveloped thewas destroyedaway from the;\n</script>\n<although theyfollowed by amore powerfulresulted in aUniversity ofHowever, manythe presidentHowever, someis thought tountil the endwas announcedare importantalso includes><input type=the center of DO NOT ALTERused to referthemes/?sort=that had beenthe basis forhas developedin the summercomparativelydescribed thesuch as thosethe resultingis impossiblevarious otherSouth Africanhave the sameeffectivenessin which case; text-align:structure and; background:regarding thesupported theis also knownstyle=\"marginincluding thebahasa Melayunorsk bokmC%lnorsk nynorskslovenE!D\rinainternacionalcalificaciC3ncomunicaciC3nconstrucciC3n\"><div class=\"disambiguationDomainName\', \'administrationsimultaneouslytransportationInternational margin-bottom:responsibility<![endif]-->\n</><meta name=\"implementationinfrastructurerepresentationborder-bottom:</head>\n<body>=http%3A%2F%2F<form method=\"method=\"post\" /favicon.ico\" });\n</script>\n.setAttribute(Administration= new Array();<![endif]-->\r\ndisplay:block;Unfortunately,\"> </div>/favicon.ico\">=\'stylesheet\' identification, for example,<li><a href=\"/an alternativeas a result ofpt\"></script>\ntype=\"submit\" \n(function() {recommendationform action=\"/transformationreconstruction.style.display According to hidden\" name=\"along with thedocument.body.approximately Communicationspost\" action=\"meaning "--<![endif]-->Prime Ministercharacteristic</a> <a class=the history of onmouseover=\"the governmenthref=\"https://was originallywas introducedclassificationrepresentativeare considered<![endif]-->\n\ndepends on theUniversity of in contrast to placeholder=\"in the case ofinternational constitutionalstyle=\"border-: function() {Because of the-strict.dtd\">\n<table class=\"accompanied byaccount of the<script src=\"/nature of the the people in in addition tos); js.id = id\" width=\"100%\"regarding the Roman Catholican independentfollowing the .gif\" width=\"1the following discriminationarchaeologicalprime minister.js\"></script>combination of marginwidth=\"createElement(w.attachEvent(</a></td></tr>src=\"https://aIn particular, align=\"left\" Czech RepublicUnited Kingdomcorrespondenceconcluded that.html\" title=\"(function () {comes from theapplication of<span class=\"sbelieved to beement(\'script\'</a>\n</li>\n<livery different><span class=\"option value=\"(also known as\t<li><a href=\"><input name=\"separated fromreferred to as valign=\"top\">founder of theattempting to carbon dioxide\n\n<div class=\"class=\"search-/body>\n</html>opportunity tocommunications</head>\r\n<body style=\"width:Tia:?ng Via;\u0007tchanges in theborder-color:#0\" border=\"0\" </span></div><was discovered\" type=\"text\" );\n</script>\n\nDepartment of ecclesiasticalthere has beenresulting from</body></html>has never beenthe first timein response toautomatically </div>\n\n<div iwas consideredpercent of the\" /></a></div>collection of descended fromsection of theaccept-charsetto be confusedmember of the padding-right:translation ofinterpretation href=\'http://whether or notThere are alsothere are manya small numberother parts ofimpossible to class=\"buttonlocated in the. However, theand eventuallyAt the end of because of itsrepresents the<form action=\" method=\"post\"it is possiblemore likely toan increase inhave also beencorresponds toannounced thatalign=\"right\">many countriesfor many yearsearliest knownbecause it waspt\"></script>\r valign=\"top\" inhabitants offollowing year\r\n<div class=\"million peoplecontroversial concerning theargue that thegovernment anda reference totransferred todescribing the style=\"color:although therebest known forsubmit\" name=\"multiplicationmore than one recognition ofCouncil of theedition of the <meta name=\"Entertainment away from the ;margin-right:at the time ofinvestigationsconnected withand many otheralthough it isbeginning with <span class=\"descendants of<span class=\"i align=\"right\"</head>\n<body aspects of thehas since beenEuropean Unionreminiscent ofmore difficultVice Presidentcomposition ofpassed throughmore importantfont-size:11pxexplanation ofthe concept ofwritten in the\t<span class=\"is one of the resemblance toon the groundswhich containsincluding the defined by thepublication ofmeans that theoutside of thesupport of the<input class=\"<span class=\"t(Math.random()most prominentdescription ofConstantinoplewere published<div class=\"seappears in the1\" height=\"1\" most importantwhich includeswhich had beendestruction ofthe population\n\t<div class=\"possibility ofsometimes usedappear to havesuccess of theintended to bepresent in thestyle=\"clear:b\r\n</script>\r\n<was founded ininterview with_id\" content=\"capital of the\r\n<link rel=\"srelease of thepoint out thatxMLHttpRequestand subsequentsecond largestvery importantspecificationssurface of theapplied to theforeign policy_setDomainNameestablished inis believed toIn addition tomeaning of theis named afterto protect theis representedDeclaration ofmore efficientClassificationother forms ofhe returned to<span class=\"cperformance of(function() {\rif and only ifregions of theleading to therelations withUnited Nationsstyle=\"height:other than theype\" content=\"Association of\n</head>\n<bodylocated on theis referred to(including theconcentrationsthe individualamong the mostthan any other/>\n<link rel=\" return false;the purpose ofthe ability to;color:#fff}\n.\n<span class=\"the subject ofdefinitions of>\r\n<link rel=\"claim that thehave developed<table width=\"celebration ofFollowing the to distinguish<span class=\"btakes place inunder the namenoted that the><![endif]-->\nstyle=\"margin-instead of theintroduced thethe process ofincreasing thedifferences inestimated thatespecially the/div><div id=\"was eventuallythroughout histhe differencesomething thatspan></span></significantly ></script>\r\n\r\nenvironmental to prevent thehave been usedespecially forunderstand theis essentiallywere the firstis the largesthave been made\" src=\"http://interpreted assecond half ofcrolling=\"no\" is composed ofII, Holy Romanis expected tohave their owndefined as thetraditionally have differentare often usedto ensure thatagreement withcontaining theare frequentlyinformation onexample is theresulting in a</a></li></ul> class=\"footerand especiallytype=\"button\" </span></span>which included>\n<meta name=\"considered thecarried out byHowever, it isbecame part ofin relation topopular in thethe capital ofwas officiallywhich has beenthe History ofalternative todifferent fromto support thesuggested thatin the process <div class=\"the foundationbecause of hisconcerned withthe universityopposed to thethe context of<span class=\"ptext\" name=\"q\"\t\t<div class=\"the scientificrepresented bymathematicianselected by thethat have been><div class=\"cdiv id=\"headerin particular,converted into);\n</script>\n<philosophical srpskohrvatskitia:?ng Via;\u0007tP Q\u0003Q\u0001Q\u0001P:P8P9Q\u0000Q\u0003Q\u0001Q\u0001P:P8P9investigaciC3nparticipaciC3nP:P>Q\u0002P>Q\u0000Q\u000bP5P>P1P;P0Q\u0001Q\u0002P8P:P>Q\u0002P>Q\u0000Q\u000bP9Q\u0007P5P;P>P2P5P:Q\u0001P8Q\u0001Q\u0002P5P<Q\u000bP\u001dP>P2P>Q\u0001Q\u0002P8P:P>Q\u0002P>Q\u0000Q\u000bQ\u0005P>P1P;P0Q\u0001Q\u0002Q\fP2Q\u0000P5P<P5P=P8P:P>Q\u0002P>Q\u0000P0Q\u000fQ\u0001P5P3P>P4P=Q\u000fQ\u0001P:P0Q\u0007P0Q\u0002Q\fP=P>P2P>Q\u0001Q\u0002P8P#P:Q\u0000P0P8P=Q\u000bP2P>P?Q\u0000P>Q\u0001Q\u000bP:P>Q\u0002P>Q\u0000P>P9Q\u0001P4P5P;P0Q\u0002Q\fP?P>P<P>Q\tQ\fQ\u000eQ\u0001Q\u0000P5P4Q\u0001Q\u0002P2P>P1Q\u0000P0P7P>P<Q\u0001Q\u0002P>Q\u0000P>P=Q\u000bQ\u0003Q\u0007P0Q\u0001Q\u0002P8P5Q\u0002P5Q\u0007P5P=P8P5P\u0013P;P0P2P=P0Q\u000fP8Q\u0001Q\u0002P>Q\u0000P8P8Q\u0001P8Q\u0001Q\u0002P5P<P0Q\u0000P5Q\bP5P=P8Q\u000fP!P:P0Q\u0007P0Q\u0002Q\fP?P>Q\rQ\u0002P>P<Q\u0003Q\u0001P;P5P4Q\u0003P5Q\u0002Q\u0001P:P0P7P0Q\u0002Q\fQ\u0002P>P2P0Q\u0000P>P2P:P>P=P5Q\u0007P=P>Q\u0000P5Q\bP5P=P8P5P:P>Q\u0002P>Q\u0000P>P5P>Q\u0000P3P0P=P>P2P:P>Q\u0002P>Q\u0000P>P<P P5P:P;P0P<P0X\'Y\u0004Y\u0005Y\u0006X*X/Y\tY\u0005Y\u0006X*X/Y\nX\'X*X\'Y\u0004Y\u0005Y\bX6Y\bX9X\'Y\u0004X(X1X\'Y\u0005X,X\'Y\u0004Y\u0005Y\bX\'Y\u0002X9X\'Y\u0004X1X3X\'X&Y\u0004Y\u0005X4X\'X1Y\u0003X\'X*X\'Y\u0004X#X9X6X\'X!X\'Y\u0004X1Y\nX\'X6X)X\'Y\u0004X*X5Y\u0005Y\nY\u0005X\'Y\u0004X\'X9X6X\'X!X\'Y\u0004Y\u0006X*X\'X&X,X\'Y\u0004X#Y\u0004X9X\'X(X\'Y\u0004X*X3X,Y\nY\u0004X\'Y\u0004X#Y\u0002X3X\'Y\u0005X\'Y\u0004X6X:X7X\'X*X\'Y\u0004Y\u0001Y\nX/Y\nY\bX\'Y\u0004X*X1X-Y\nX(X\'Y\u0004X,X/Y\nX/X)X\'Y\u0004X*X9Y\u0004Y\nY\u0005X\'Y\u0004X#X.X(X\'X1X\'Y\u0004X\'Y\u0001Y\u0004X\'Y\u0005X\'Y\u0004X#Y\u0001Y\u0004X\'Y\u0005X\'Y\u0004X*X\'X1Y\nX.X\'Y\u0004X*Y\u0002Y\u0006Y\nX)X\'Y\u0004X\'Y\u0004X9X\'X(X\'Y\u0004X.Y\bX\'X7X1X\'Y\u0004Y\u0005X,X*Y\u0005X9X\'Y\u0004X/Y\nY\u0003Y\bX1X\'Y\u0004X3Y\nX\'X-X)X9X(X/X\'Y\u0004Y\u0004Y\u0007X\'Y\u0004X*X1X(Y\nX)X\'Y\u0004X1Y\bX\'X(X7X\'Y\u0004X#X/X(Y\nX)X\'Y\u0004X\'X.X(X\'X1X\'Y\u0004Y\u0005X*X-X/X)X\'Y\u0004X\'X:X\'Y\u0006Y\ncursor:pointer;</title>\n<meta \" href=\"http://\"><span class=\"members of the window.locationvertical-align:/a> | <a href=\"<!doctype html>media=\"screen\" <option value=\"favicon.ico\" />\n\t\t<div class=\"characteristics\" method=\"get\" /body>\n</html>\nshortcut icon\" document.write(padding-bottom:representativessubmit\" value=\"align=\"center\" throughout the science fiction\n <div class=\"submit\" class=\"one of the most valign=\"top\"><was established);\r\n</script>\r\nreturn false;\">).style.displaybecause of the document.cookie<form action=\"/}body{margin:0;Encyclopedia ofversion of the .createElement(name\" content=\"</div>\n</div>\n\nadministrative </body>\n</html>history of the \"><input type=\"portion of the as part of the <a href=\"other countries\">\n<div class=\"</span></span><In other words,display: block;control of the introduction of/>\n<meta name=\"as well as the in recent years\r\n\t<div class=\"</div>\n\t</div>\ninspired by thethe end of the compatible withbecame known as style=\"margin:.js\"></script>< International there have beenGerman language style=\"color:#Communist Partyconsistent withborder=\"0\" cell marginheight=\"the majority of\" align=\"centerrelated to the many different Orthodox Churchsimilar to the />\n<link rel=\"swas one of the until his death})();\n</script>other languagescompared to theportions of thethe Netherlandsthe most commonbackground:url(argued that thescrolling=\"no\" included in theNorth American the name of theinterpretationsthe traditionaldevelopment of frequently useda collection ofvery similar tosurrounding theexample of thisalign=\"center\">would have beenimage_caption =attached to thesuggesting thatin the form of involved in theis derived fromnamed after theIntroduction torestrictions on style=\"width: can be used to the creation ofmost important information andresulted in thecollapse of theThis means thatelements of thewas replaced byanalysis of theinspiration forregarded as themost successfulknown as "a comprehensiveHistory of the were consideredreturned to theare referred toUnsourced image>\n\t<div class=\"consists of thestopPropagationinterest in theavailability ofappears to haveelectromagneticenableServices(function of theIt is important</script></div>function(){var relative to theas a result of the position ofFor example, in method=\"post\" was followed by&mdash; thethe applicationjs\"></script>\r\nul></div></div>after the deathwith respect tostyle=\"padding:is particularlydisplay:inline; type=\"submit\" is divided intod8-f\u0016\u0007 (g.\u0000d=\u0013)responsabilidadadministraciC3ninternacionalescorrespondiente`$\t`$*`$/`%\u000b`$\u0017`$*`%\u0002`$0`%\r`$5`$9`$.`$>`$0`%\u0007`$2`%\u000b`$\u0017`%\u000b`$\u0002`$\u001a`%\u0001`$(`$>`$5`$2`%\u0007`$\u0015`$?`$(`$8`$0`$\u0015`$>`$0`$*`%\u0001`$2`$?`$8`$\u0016`%\u000b`$\u001c`%\u0007`$\u0002`$\u001a`$>`$9`$?`$\u000f`$-`%\u0007`$\u001c`%\u0007`$\u0002`$6`$>`$.`$?`$2`$9`$.`$>`$0`%\u0000`$\u001c`$>`$\u0017`$0`$#`$,`$(`$>`$(`%\u0007`$\u0015`%\u0001`$.`$>`$0`$,`%\r`$2`%\t`$\u0017`$.`$>`$2`$?`$\u0015`$.`$9`$?`$2`$>`$*`%\u0003`$7`%\r`$ `$,`$\"`$<`$$`%\u0007`$-`$>`$\u001c`$*`$>`$\u0015`%\r`$2`$?`$\u0015`$\u001f`%\r`$0`%\u0007`$(`$\u0016`$?`$2`$>`$+`$&`%\f`$0`$>`$(`$.`$>`$.`$2`%\u0007`$.`$$`$&`$>`$(`$,`$>`$\u001c`$>`$0`$5`$?`$\u0015`$>`$8`$\u0015`%\r`$/`%\u000b`$\u0002`$\u001a`$>`$9`$$`%\u0007`$*`$9`%\u0001`$\u0001`$\u001a`$,`$$`$>`$/`$>`$8`$\u0002`$5`$>`$&`$&`%\u0007`$\u0016`$(`%\u0007`$*`$?`$\u001b`$2`%\u0007`$5`$?`$6`%\u0007`$7`$0`$>`$\u001c`%\r`$/`$\t`$$`%\r`$$`$0`$.`%\u0001`$\u0002`$,`$\b`$&`%\u000b`$(`%\u000b`$\u0002`$\t`$*`$\u0015`$0`$#`$*`$\"`$<`%\u0007`$\u0002`$8`%\r`$%`$?`$$`$+`$?`$2`%\r`$.`$.`%\u0001`$\u0016`%\r`$/`$\u0005`$\u001a`%\r`$\u001b`$>`$\u001b`%\u0002`$\u001f`$$`%\u0000`$8`$\u0002`$\u0017`%\u0000`$$`$\u001c`$>`$\u000f`$\u0017`$>`$5`$?`$-`$>`$\u0017`$\u0018`$#`%\r`$\u001f`%\u0007`$&`%\u0002`$8`$0`%\u0007`$&`$?`$(`%\u000b`$\u0002`$9`$$`%\r`$/`$>`$8`%\u0007`$\u0015`%\r`$8`$\u0017`$>`$\u0002`$\'`%\u0000`$5`$?`$6`%\r`$5`$0`$>`$$`%\u0007`$\u0002`$&`%\b`$\u001f`%\r`$8`$(`$\u0015`%\r`$6`$>`$8`$>`$.`$(`%\u0007`$\u0005`$&`$>`$2`$$`$,`$?`$\u001c`$2`%\u0000`$*`%\u0001`$0`%\u0002`$7`$9`$?`$\u0002`$&`%\u0000`$.`$?`$$`%\r`$0`$\u0015`$5`$?`$$`$>`$0`%\u0001`$*`$/`%\u0007`$8`%\r`$%`$>`$(`$\u0015`$0`%\u000b`$!`$<`$.`%\u0001`$\u0015`%\r`$$`$/`%\u000b`$\u001c`$(`$>`$\u0015`%\u0003`$*`$/`$>`$*`%\u000b`$8`%\r`$\u001f`$\u0018`$0`%\u0007`$2`%\u0002`$\u0015`$>`$0`%\r`$/`$5`$?`$\u001a`$>`$0`$8`%\u0002`$\u001a`$(`$>`$.`%\u0002`$2`%\r`$/`$&`%\u0007`$\u0016`%\u0007`$\u0002`$9`$.`%\u0007`$6`$>`$8`%\r`$\u0015`%\u0002`$2`$.`%\b`$\u0002`$(`%\u0007`$$`%\b`$/`$>`$0`$\u001c`$?`$8`$\u0015`%\u0007rss+xml\" title=\"-type\" content=\"title\" content=\"at the same time.js\"></script>\n<\" method=\"post\" </span></a></li>vertical-align:t/jquery.min.js\">.click(function( style=\"padding-})();\n</script>\n</span><a href=\"<a href=\"http://); return false;text-decoration: scrolling=\"no\" border-collapse:associated with Bahasa IndonesiaEnglish language<text xml:space=.gif\" border=\"0\"</body>\n</html>\noverflow:hidden;img src=\"http://addEventListenerresponsible for s.js\"></script>\n/favicon.ico\" />operating system\" style=\"width:1target=\"_blank\">State Universitytext-align:left;\ndocument.write(, including the around the world);\r\n</script>\r\n<\" style=\"height:;overflow:hiddenmore informationan internationala member of the one of the firstcan be found in </div>\n\t\t</div>\ndisplay: none;\">\" />\n<link rel=\"\n (function() {the 15th century.preventDefault(large number of Byzantine Empire.jpg|thumb|left|vast majority ofmajority of the align=\"center\">University Pressdominated by theSecond World Wardistribution of style=\"position:the rest of the characterized by rel=\"nofollow\">derives from therather than the a combination ofstyle=\"width:100English-speakingcomputer scienceborder=\"0\" alt=\"the existence ofDemocratic Party\" style=\"margin-For this reason,.js\"></script>\n\tsByTagName(s)[0]js\"></script>\r\n<.js\"></script>\r\nlink rel=\"icon\" \' alt=\'\' class=\'formation of theversions of the </a></div></div>/page>\n <page>\n<div class=\"contbecame the firstbahasa Indonesiaenglish (simple)N\u0015N;N;N7N=N9N:N,Q\u0005Q\u0000P2P0Q\u0002Q\u0001P:P8P:P>P<P?P0P=P8P8Q\u000fP2P;Q\u000fP5Q\u0002Q\u0001Q\u000fP\u0014P>P1P0P2P8Q\u0002Q\fQ\u0007P5P;P>P2P5P:P0Q\u0000P0P7P2P8Q\u0002P8Q\u000fP\u0018P=Q\u0002P5Q\u0000P=P5Q\u0002P\u001eQ\u0002P2P5Q\u0002P8Q\u0002Q\fP=P0P?Q\u0000P8P<P5Q\u0000P8P=Q\u0002P5Q\u0000P=P5Q\u0002P:P>Q\u0002P>Q\u0000P>P3P>Q\u0001Q\u0002Q\u0000P0P=P8Q\u0006Q\u000bP:P0Q\u0007P5Q\u0001Q\u0002P2P5Q\u0003Q\u0001P;P>P2P8Q\u000fQ\u0005P?Q\u0000P>P1P;P5P<Q\u000bP?P>P;Q\u0003Q\u0007P8Q\u0002Q\fQ\u000fP2P;Q\u000fQ\u000eQ\u0002Q\u0001Q\u000fP=P0P8P1P>P;P5P5P:P>P<P?P0P=P8Q\u000fP2P=P8P<P0P=P8P5Q\u0001Q\u0000P5P4Q\u0001Q\u0002P2P0X\'Y\u0004Y\u0005Y\bX\'X6Y\nX9X\'Y\u0004X1X&Y\nX3Y\nX)X\'Y\u0004X\'Y\u0006X*Y\u0002X\'Y\u0004Y\u0005X4X\'X1Y\u0003X\'X*Y\u0003X\'Y\u0004X3Y\nX\'X1X\'X*X\'Y\u0004Y\u0005Y\u0003X*Y\bX(X)X\'Y\u0004X3X9Y\bX/Y\nX)X\'X-X5X\'X&Y\nX\'X*X\'Y\u0004X9X\'Y\u0004Y\u0005Y\nX)X\'Y\u0004X5Y\bX*Y\nX\'X*X\'Y\u0004X\'Y\u0006X*X1Y\u0006X*X\'Y\u0004X*X5X\'Y\u0005Y\nY\u0005X\'Y\u0004X%X3Y\u0004X\'Y\u0005Y\nX\'Y\u0004Y\u0005X4X\'X1Y\u0003X)X\'Y\u0004Y\u0005X1X&Y\nX\'X*robots\" content=\"<div id=\"footer\">the United States<img src=\"http://.jpg|right|thumb|.js\"></script>\r\n<location.protocolframeborder=\"0\" s\" />\n<meta name=\"</a></div></div><font-weight:bold;" and "depending on the margin:0;padding:\" rel=\"nofollow\" President of the twentieth centuryevision>\n </pageInternet Explorera.async = true;\r\ninformation about<div id=\"header\">\" action=\"http://<a href=\"https://<div id=\"content\"</div>\r\n</div>\r\n<derived from the <img src=\'http://according to the \n</body>\n</html>\nstyle=\"font-size:script language=\"Arial, Helvetica,</a><span class=\"</script><script political partiestd></tr></table><href=\"http://www.interpretation ofrel=\"stylesheet\" document.write(\'<charset=\"utf-8\">\nbeginning of the revealed that thetelevision series\" rel=\"nofollow\"> target=\"_blank\">claiming that thehttp%3A%2F%2Fwww.manifestations ofPrime Minister ofinfluenced by theclass=\"clearfix\">/div>\r\n</div>\r\n\r\nthree-dimensionalChurch of Englandof North Carolinasquare kilometres.addEventListenerdistinct from thecommonly known asPhonetic Alphabetdeclared that thecontrolled by theBenjamin Franklinrole-playing gamethe University ofin Western Europepersonal computerProject Gutenbergregardless of thehas been proposedtogether with the></li><li class=\"in some countriesmin.js\"></script>of the populationofficial language<img src=\"images/identified by thenatural resourcesclassification ofcan be consideredquantum mechanicsNevertheless, themillion years ago</body>\r\n</html>\rN\u0015N;N;N7N=N9N:N,\ntake advantage ofand, according toattributed to theMicrosoft Windowsthe first centuryunder the controldiv class=\"headershortly after thenotable exceptiontens of thousandsseveral differentaround the world.reaching militaryisolated from theopposition to thethe Old TestamentAfrican Americansinserted into theseparate from themetropolitan areamakes it possibleacknowledged thatarguably the mosttype=\"text/css\">\nthe InternationalAccording to the pe=\"text/css\" />\ncoincide with thetwo-thirds of theDuring this time,during the periodannounced that hethe internationaland more recentlybelieved that theconsciousness andformerly known assurrounded by thefirst appeared inoccasionally usedposition:absolute;\" target=\"_blank\" position:relative;text-align:center;jax/libs/jquery/1.background-color:#type=\"application/anguage\" content=\"<meta http-equiv=\"Privacy Policy</a>e(\"%3Cscript src=\'\" target=\"_blank\">On the other hand,.jpg|thumb|right|2</div><div class=\"<div style=\"float:nineteenth century</body>\r\n</html>\r\n<img src=\"http://s;text-align:centerfont-weight: bold; According to the difference between\" frameborder=\"0\" \" style=\"position:link href=\"http://html4/loose.dtd\">\nduring this period</td></tr></table>closely related tofor the first time;font-weight:bold;input type=\"text\" <span style=\"font-onreadystatechange\t<div class=\"cleardocument.location. For example, the a wide variety of <!DOCTYPE html>\r\n< \"><a href=\"http://style=\"float:left;concerned with the=http%3A%2F%2Fwww.in popular culturetype=\"text/css\" />it is possible to Harvard Universitytylesheet\" href=\"/the main characterOxford University name=\"keywords\" cstyle=\"text-align:the United Kingdomfederal government<div style=\"margin depending on the description of the<div class=\"header.min.js\"></script>destruction of theslightly differentin accordance withtelecommunicationsindicates that theshortly thereafterespecially in the European countriesHowever, there aresrc=\"http://staticsuggested that the\" src=\"http://www.a large number of Telecommunications\" rel=\"nofollow\" tHoly Roman Emperoralmost exclusively\" border=\"0\" alt=\"Secretary of Stateculminating in theCIA World Factbookthe most importantanniversary of thestyle=\"background-<li><em><a href=\"/the Atlantic Oceanstrictly speaking,shortly before thedifferent types ofthe Ottoman Empire><img src=\"http://An Introduction toconsequence of thedeparture from theConfederate Statesindigenous peoplesProceedings of theinformation on thetheories have beeninvolvement in thedivided into threeadjacent countriesis responsible fordissolution of thecollaboration withwidely regarded ashis contemporariesfounding member ofDominican Republicgenerally acceptedthe possibility ofare also availableunder constructionrestoration of thethe general publicis almost entirelypasses through thehas been suggestedcomputer and videoGermanic languages according to the different from theshortly afterwardshref=\"https://www.recent developmentBoard of Directors<div class=\"search| <a href=\"http://In particular, theMultiple footnotesor other substancethousands of yearstranslation of the</div>\r\n</div>\r\n\r\n<a href=\"index.phpwas established inmin.js\"></script>\nparticipate in thea strong influencestyle=\"margin-top:represented by thegraduated from theTraditionally, theElement(\"script\");However, since the/div>\n</div>\n<div left; margin-left:protection against0; vertical-align:Unfortunately, thetype=\"image/x-icon/div>\n<div class=\" class=\"clearfix\"><div class=\"footer\t\t</div>\n\t\t</div>\nthe motion pictureP\u0011Q\nP;P3P0Q\u0000Q\u0001P:P8P1Q\nP;P3P0Q\u0000Q\u0001P:P8P$P5P4P5Q\u0000P0Q\u0006P8P8P=P5Q\u0001P:P>P;Q\fP:P>Q\u0001P>P>P1Q\tP5P=P8P5Q\u0001P>P>P1Q\tP5P=P8Q\u000fP?Q\u0000P>P3Q\u0000P0P<P<Q\u000bP\u001eQ\u0002P?Q\u0000P0P2P8Q\u0002Q\fP1P5Q\u0001P?P;P0Q\u0002P=P>P<P0Q\u0002P5Q\u0000P8P0P;Q\u000bP?P>P7P2P>P;Q\u000fP5Q\u0002P?P>Q\u0001P;P5P4P=P8P5Q\u0000P0P7P;P8Q\u0007P=Q\u000bQ\u0005P?Q\u0000P>P4Q\u0003P:Q\u0006P8P8P?Q\u0000P>P3Q\u0000P0P<P<P0P?P>P;P=P>Q\u0001Q\u0002Q\fQ\u000eP=P0Q\u0005P>P4P8Q\u0002Q\u0001Q\u000fP8P7P1Q\u0000P0P=P=P>P5P=P0Q\u0001P5P;P5P=P8Q\u000fP8P7P<P5P=P5P=P8Q\u000fP:P0Q\u0002P5P3P>Q\u0000P8P8P\u0010P;P5P:Q\u0001P0P=P4Q\u0000`$&`%\r`$5`$>`$0`$>`$.`%\b`$(`%\u0001`$\u0005`$2`$*`%\r`$0`$&`$>`$(`$-`$>`$0`$$`%\u0000`$/`$\u0005`$(`%\u0001`$&`%\u0007`$6`$9`$?`$(`%\r`$&`%\u0000`$\u0007`$\u0002`$!`$?`$/`$>`$&`$?`$2`%\r`$2`%\u0000`$\u0005`$\'`$?`$\u0015`$>`$0`$5`%\u0000`$!`$?`$/`%\u000b`$\u001a`$?`$\u001f`%\r`$ `%\u0007`$8`$.`$>`$\u001a`$>`$0`$\u001c`$\u0002`$\u0015`%\r`$6`$(`$&`%\u0001`$(`$?`$/`$>`$*`%\r`$0`$/`%\u000b`$\u0017`$\u0005`$(`%\u0001`$8`$>`$0`$\u0011`$(`$2`$>`$\u0007`$(`$*`$>`$0`%\r`$\u001f`%\u0000`$6`$0`%\r`$$`%\u000b`$\u0002`$2`%\u000b`$\u0015`$8`$-`$>`$+`$<`%\r`$2`%\b`$6`$6`$0`%\r`$$`%\u0007`$\u0002`$*`%\r`$0`$&`%\u0007`$6`$*`%\r`$2`%\u0007`$/`$0`$\u0015`%\u0007`$\u0002`$&`%\r`$0`$8`%\r`$%`$?`$$`$?`$\t`$$`%\r`$*`$>`$&`$\t`$(`%\r`$9`%\u0007`$\u0002`$\u001a`$?`$\u001f`%\r`$ `$>`$/`$>`$$`%\r`$0`$>`$\u001c`%\r`$/`$>`$&`$>`$*`%\u0001`$0`$>`$(`%\u0007`$\u001c`%\u000b`$!`$<`%\u0007`$\u0002`$\u0005`$(`%\u0001`$5`$>`$&`$6`%\r`$0`%\u0007`$#`%\u0000`$6`$?`$\u0015`%\r`$7`$>`$8`$0`$\u0015`$>`$0`%\u0000`$8`$\u0002`$\u0017`%\r`$0`$9`$*`$0`$?`$#`$>`$.`$,`%\r`$0`$>`$\u0002`$!`$,`$\u001a`%\r`$\u001a`%\u000b`$\u0002`$\t`$*`$2`$,`%\r`$\'`$.`$\u0002`$$`%\r`$0`%\u0000`$8`$\u0002`$*`$0`%\r`$\u0015`$\t`$.`%\r`$.`%\u0000`$&`$.`$>`$\'`%\r`$/`$.`$8`$9`$>`$/`$$`$>`$6`$,`%\r`$&`%\u000b`$\u0002`$.`%\u0000`$!`$?`$/`$>`$\u0006`$\b`$*`%\u0000`$\u000f`$2`$.`%\u000b`$,`$>`$\u0007`$2`$8`$\u0002`$\u0016`%\r`$/`$>`$\u0006`$*`$0`%\u0007`$6`$(`$\u0005`$(`%\u0001`$,`$\u0002`$\'`$,`$>`$\u001c`$<`$>`$0`$(`$5`%\u0000`$(`$$`$.`$*`%\r`$0`$.`%\u0001`$\u0016`$*`%\r`$0`$6`%\r`$(`$*`$0`$?`$5`$>`$0`$(`%\u0001`$\u0015`$8`$>`$(`$8`$.`$0`%\r`$%`$(`$\u0006`$/`%\u000b`$\u001c`$?`$$`$8`%\u000b`$.`$5`$>`$0X\'Y\u0004Y\u0005X4X\'X1Y\u0003X\'X*X\'Y\u0004Y\u0005Y\u0006X*X/Y\nX\'X*X\'Y\u0004Y\u0003Y\u0005X(Y\nY\bX*X1X\'Y\u0004Y\u0005X4X\'Y\u0007X/X\'X*X9X/X/X\'Y\u0004X2Y\bX\'X1X9X/X/X\'Y\u0004X1X/Y\bX/X\'Y\u0004X%X3Y\u0004X\'Y\u0005Y\nX)X\'Y\u0004Y\u0001Y\bX*Y\bX4Y\bX(X\'Y\u0004Y\u0005X3X\'X(Y\u0002X\'X*X\'Y\u0004Y\u0005X9Y\u0004Y\bY\u0005X\'X*X\'Y\u0004Y\u0005X3Y\u0004X3Y\u0004X\'X*X\'Y\u0004X,X1X\'Y\u0001Y\nY\u0003X3X\'Y\u0004X\'X3Y\u0004X\'Y\u0005Y\nX)X\'Y\u0004X\'X*X5X\'Y\u0004X\'X*keywords\" content=\"w3.org/1999/xhtml\"><a target=\"_blank\" text/html; charset=\" target=\"_blank\"><table cellpadding=\"autocomplete=\"off\" text-align: center;to last version by background-color: #\" href=\"http://www./div></div><div id=<a href=\"#\" class=\"\"><img src=\"http://cript\" src=\"http://\n<script language=\"//EN\" \"http://www.wencodeURIComponent(\" href=\"javascript:<div class=\"contentdocument.write(\'<scposition: absolute;script src=\"http:// style=\"margin-top:.min.js\"></script>\n</div>\n<div class=\"w3.org/1999/xhtml\" \n\r\n</body>\r\n</html>distinction between/\" target=\"_blank\"><link href=\"http://encoding=\"utf-8\"?>\nw.addEventListener?action=\"http://www.icon\" href=\"http:// style=\"background:type=\"text/css\" />\nmeta property=\"og:t<input type=\"text\" style=\"text-align:the development of tylesheet\" type=\"tehtml; charset=utf-8is considered to betable width=\"100%\" In addition to the contributed to the differences betweendevelopment of the It is important to </script>\n\n<script style=\"font-size:1></span><span id=gbLibrary of Congress<img src=\"http://imEnglish translationAcademy of Sciencesdiv style=\"display:construction of the.getElementById(id)in conjunction withElement(\'script\'); <meta property=\"og:P\u0011Q\nP;P3P0Q\u0000Q\u0001P:P8\n type=\"text\" name=\">Privacy Policy</a>administered by theenableSingleRequeststyle="margin:</div></div></div><><img src=\"http://i style="float:referred to as the total population ofin Washington, D.C. style=\"background-among other things,organization of theparticipated in thethe introduction ofidentified with thefictional character Oxford University misunderstanding ofThere are, however,stylesheet\" href=\"/Columbia Universityexpanded to includeusually referred toindicating that thehave suggested thataffiliated with thecorrelation betweennumber of different></td></tr></table>Republic of Ireland\n</script>\n<script under the influencecontribution to theOfficial website ofheadquarters of thecentered around theimplications of thehave been developedFederal Republic ofbecame increasinglycontinuation of theNote, however, thatsimilar to that of capabilities of theaccordance with theparticipants in thefurther developmentunder the directionis often consideredhis younger brother</td></tr></table><a http-equiv=\"X-UA-physical propertiesof British Columbiahas been criticized(with the exceptionquestions about thepassing through the0\" cellpadding=\"0\" thousands of peopleredirects here. Forhave children under%3E%3C/script%3E\"));<a href=\"http://www.<li><a href=\"http://site_name\" content=\"text-decoration:nonestyle=\"display: none<meta http-equiv=\"X-new Date().getTime() type=\"image/x-icon\"</span><span class=\"language=\"javascriptwindow.location.href<a href=\"javascript:-->\r\n<script type=\"t<a href=\'http://www.hortcut icon\" href=\"</div>\r\n<div class=\"<script src=\"http://\" rel=\"stylesheet\" t</div>\n<script type=/a> <a href=\"http:// allowTransparency=\"X-UA-Compatible\" conrelationship between\n</script>\r\n<script </a></li></ul></div>associated with the programming language</a><a href=\"http://</a></li><li class=\"form action=\"http://<div style=\"display:type=\"text\" name=\"q\"<table width=\"100%\" background-position:\" border=\"0\" width=\"rel=\"shortcut icon\" h6><ul><li><a href=\" <meta http-equiv=\"css\" media=\"screen\" responsible for the \" type=\"application/\" style=\"background-html; charset=utf-8\" allowtransparency=\"stylesheet\" type=\"te\r\n<meta http-equiv=\"></span><span class=\"0\" cellspacing=\"0\">;\n</script>\n<script sometimes called thedoes not necessarilyFor more informationat the beginning of <!DOCTYPE html><htmlparticularly in the type=\"hidden\" name=\"javascript:void(0);\"effectiveness of the autocomplete=\"off\" generally considered><input type=\"text\" \"></script>\r\n<scriptthroughout the worldcommon misconceptionassociation with the</div>\n</div>\n<div cduring his lifetime,corresponding to thetype=\"image/x-icon\" an increasing numberdiplomatic relationsare often consideredmeta charset=\"utf-8\" <input type=\"text\" examples include the\"><img src=\"http://iparticipation in thethe establishment of\n</div>\n<div class=\"&nbsp;&nbsp;to determine whetherquite different frommarked the beginningdistance between thecontributions to theconflict between thewidely considered towas one of the firstwith varying degreeshave speculated that(document.getElementparticipating in theoriginally developedeta charset=\"utf-8\"> type=\"text/css\" />\ninterchangeably withmore closely relatedsocial and politicalthat would otherwiseperpendicular to thestyle type=\"text/csstype=\"submit\" name=\"families residing indeveloping countriescomputer programmingeconomic developmentdetermination of thefor more informationon several occasionsportuguC*s (Europeu)P#P:Q\u0000P0Q\u0017P=Q\u0001Q\fP:P0Q\u0003P:Q\u0000P0Q\u0017P=Q\u0001Q\fP:P0P P>Q\u0001Q\u0001P8P9Q\u0001P:P>P9P<P0Q\u0002P5Q\u0000P8P0P;P>P2P8P=Q\u0004P>Q\u0000P<P0Q\u0006P8P8Q\u0003P?Q\u0000P0P2P;P5P=P8Q\u000fP=P5P>P1Q\u0005P>P4P8P<P>P8P=Q\u0004P>Q\u0000P<P0Q\u0006P8Q\u000fP\u0018P=Q\u0004P>Q\u0000P<P0Q\u0006P8Q\u000fP P5Q\u0001P?Q\u0003P1P;P8P:P8P:P>P;P8Q\u0007P5Q\u0001Q\u0002P2P>P8P=Q\u0004P>Q\u0000P<P0Q\u0006P8Q\u000eQ\u0002P5Q\u0000Q\u0000P8Q\u0002P>Q\u0000P8P8P4P>Q\u0001Q\u0002P0Q\u0002P>Q\u0007P=P>X\'Y\u0004Y\u0005X*Y\bX\'X,X/Y\bY\u0006X\'Y\u0004X\'X4X*X1X\'Y\u0003X\'X*X\'Y\u0004X\'Y\u0002X*X1X\'X-X\'X*html; charset=UTF-8\" setTimeout(function()display:inline-block;<input type=\"submit\" type = \'text/javascri<img src=\"http://www.\" \"http://www.w3.org/shortcut icon\" href=\"\" autocomplete=\"off\" </a></div><div class=</a></li>\n<li class=\"css\" type=\"text/css\" <form action=\"http://xt/css\" href=\"http://link rel=\"alternate\" \r\n<script type=\"text/ onclick=\"javascript:(new Date).getTime()}height=\"1\" width=\"1\" People\'s Republic of <a href=\"http://www.text-decoration:underthe beginning of the </div>\n</div>\n</div>\nestablishment of the </div></div></div></d#viewport{min-height:\n<script src=\"http://option><option value=often referred to as /option>\n<option valu<!DOCTYPE html>\n<!--[International Airport>\n<a href=\"http://www</a><a href=\"http://w`8 `82`8)`82`9\u0004`8\u0017`8\"a\u0003%a\u0003\u0010a\u0003 a\u0003\u0017a\u0003#a\u0003\u001aa\u0003\u0018f-#i+\u0014d8-f\u0016\u0007 (g9\u0001i+\u0014)`$(`$?`$0`%\r`$&`%\u0007`$6`$!`$>`$\t`$(`$2`%\u000b`$!`$\u0015`%\r`$7`%\u0007`$$`%\r`$0`$\u001c`$>`$(`$\u0015`$>`$0`%\u0000`$8`$\u0002`$,`$\u0002`$\'`$?`$$`$8`%\r`$%`$>`$*`$(`$>`$8`%\r`$5`%\u0000`$\u0015`$>`$0`$8`$\u0002`$8`%\r`$\u0015`$0`$#`$8`$>`$.`$\u0017`%\r`$0`%\u0000`$\u001a`$?`$\u001f`%\r`$ `%\u000b`$\u0002`$5`$?`$\u001c`%\r`$\u001e`$>`$(`$\u0005`$.`%\u0007`$0`$?`$\u0015`$>`$5`$?`$-`$?`$(`%\r`$(`$\u0017`$>`$!`$?`$/`$>`$\u0001`$\u0015`%\r`$/`%\u000b`$\u0002`$\u0015`$?`$8`%\u0001`$0`$\u0015`%\r`$7`$>`$*`$9`%\u0001`$\u0001`$\u001a`$$`%\u0000`$*`%\r`$0`$,`$\u0002`$\'`$(`$\u001f`$?`$*`%\r`$*`$#`%\u0000`$\u0015`%\r`$0`$?`$\u0015`%\u0007`$\u001f`$*`%\r`$0`$>`$0`$\u0002`$-`$*`%\r`$0`$>`$*`%\r`$$`$.`$>`$2`$?`$\u0015`%\u000b`$\u0002`$0`$+`$<`%\r`$$`$>`$0`$(`$?`$0`%\r`$.`$>`$#`$2`$?`$.`$?`$\u001f`%\u0007`$!description\" content=\"document.location.prot.getElementsByTagName(<!DOCTYPE html>\n<html <meta charset=\"utf-8\">:url\" content=\"http://.css\" rel=\"stylesheet\"style type=\"text/css\">type=\"text/css\" href=\"w3.org/1999/xhtml\" xmltype=\"text/javascript\" method=\"get\" action=\"link rel=\"stylesheet\" = document.getElementtype=\"image/x-icon\" />cellpadding=\"0\" cellsp.css\" type=\"text/css\" </a></li><li><a href=\"\" width=\"1\" height=\"1\"\"><a href=\"http://www.style=\"display:none;\">alternate\" type=\"appli-//W3C//DTD XHTML 1.0 ellspacing=\"0\" cellpad type=\"hidden\" value=\"/a> <span role=\"s\n<input type=\"hidden\" language=\"JavaScript\" document.getElementsBg=\"0\" cellspacing=\"0\" ype=\"text/css\" media=\"type=\'text/javascript\'with the exception of ype=\"text/css\" rel=\"st height=\"1\" width=\"1\" =\'+encodeURIComponent(<link rel=\"alternate\" \nbody, tr, input, textmeta name=\"robots\" conmethod=\"post\" action=\">\n<a href=\"http://www.css\" rel=\"stylesheet\" </div></div><div classlanguage=\"javascript\">aria-hidden=\"true\">B7<ript\" type=\"text/javasl=0;})();\n(function(){background-image: url(/a></li><li><a href=\"h\t\t<li><a href=\"http://ator\" aria-hidden=\"tru> <a href=\"http://www.language=\"javascript\" /option>\n<option value/div></div><div class=rator\" aria-hidden=\"tre=(new Date).getTime()portuguC*s (do Brasil)P>Q\u0000P3P0P=P8P7P0Q\u0006P8P8P2P>P7P<P>P6P=P>Q\u0001Q\u0002Q\fP>P1Q\u0000P0P7P>P2P0P=P8Q\u000fQ\u0000P5P3P8Q\u0001Q\u0002Q\u0000P0Q\u0006P8P8P2P>P7P<P>P6P=P>Q\u0001Q\u0002P8P>P1Q\u000fP7P0Q\u0002P5P;Q\fP=P0<!DOCTYPE html PUBLIC \"nt-Type\" content=\"text/<meta http-equiv=\"Conteransitional//EN\" \"http:<html xmlns=\"http://www-//W3C//DTD XHTML 1.0 TDTD/xhtml1-transitional//www.w3.org/TR/xhtml1/pe = \'text/javascript\';<meta name=\"descriptionparentNode.insertBefore<input type=\"hidden\" najs\" type=\"text/javascri(document).ready(functiscript type=\"text/javasimage\" content=\"http://UA-Compatible\" content=tml; charset=utf-8\" />\nlink rel=\"shortcut icon<link rel=\"stylesheet\" </script>\n<script type== document.createElemen<a target=\"_blank\" href= document.getElementsBinput type=\"text\" name=a.type = \'text/javascrinput type=\"hidden\" namehtml; charset=utf-8\" />dtd\">\n<html xmlns=\"http-//W3C//DTD HTML 4.01 TentsByTagName(\'script\')input type=\"hidden\" nam<script type=\"text/javas\" style=\"display:none;\">document.getElementById(=document.createElement(\' type=\'text/javascript\'input type=\"text\" name=\"d.getElementsByTagName(snical\" href=\"http://www.C//DTD HTML 4.01 Transit<style type=\"text/css\">\n\n<style type=\"text/css\">ional.dtd\">\n<html xmlns=http-equiv=\"Content-Typeding=\"0\" cellspacing=\"0\"html; charset=utf-8\" />\n style=\"display:none;\"><<li><a href=\"http://www. type=\'text/javascript\'>P4P5Q\u000fQ\u0002P5P;Q\fP=P>Q\u0001Q\u0002P8Q\u0001P>P>Q\u0002P2P5Q\u0002Q\u0001Q\u0002P2P8P8P?Q\u0000P>P8P7P2P>P4Q\u0001Q\u0002P2P0P1P5P7P>P?P0Q\u0001P=P>Q\u0001Q\u0002P8`$*`%\u0001`$8`%\r`$$`$?`$\u0015`$>`$\u0015`$>`$\u0002`$\u0017`%\r`$0`%\u0007`$8`$\t`$(`%\r`$9`%\u000b`$\u0002`$(`%\u0007`$5`$?`$\'`$>`$(`$8`$-`$>`$+`$?`$\u0015`%\r`$8`$?`$\u0002`$\u0017`$8`%\u0001`$0`$\u0015`%\r`$7`$?`$$`$\u0015`%\t`$*`%\u0000`$0`$>`$\u0007`$\u001f`$5`$?`$\u001c`%\r`$\u001e`$>`$*`$(`$\u0015`$>`$0`%\r`$0`$5`$>`$\b`$8`$\u0015`%\r`$0`$?`$/`$$`$>"
private static final String
"\u06d2\u0000\u0167\u0002/\u0000`\u00022\u0000\u00b2\u0000*\u0000B\u0000\u0081\u0001\u016e\u0000\u01c0\u0001\u0019\u0001\u0005\u0001\u0002\u00019\u0001c\u0153\u0c19\u0001\u0188\u0001\u016d\u0001\u0004\u00019\u0001\u0000\u0001\u0002\u0001]\u0001+\u0001\f\u0001\u008c\u0001\u000e\u00018\u0001H\u0001P\u0001 \u0001O\u0001\u001e\u0001\u00aa\u00011\u00011\u0001\n\u0001\u0019\u0001\u0011\u0001\u0f51\u1757J\u0001K\u0001\u001b\u0001 \u0001(\u0001+\u0001S\u0001\u001b\u0001!\u0001@\u0001\u00a7\u0001\u0012\u0001\u0015\u0001\u0003\u0001\u001f\u0001\u000b\u0001\u001e\u0001\u0004\u0001\t\u0001!\u0001\b\u0001\f\u0001\u0003\u0001\'\u0001!\u0001\f\u0239\u0005\u03c5\u21ce\u0001\u134d\u0001&\u0001\u0016\u0001\u0004\u0001 \u0001#\u0001+\u0001\u000b\u0001\u001a\u0001\u0014\u00011\u0001\\\u0001\b\u0001Q\u0001<\u0001\u0007\u0001 \u0001\u0004\u0001\u001a\u0001\u0018\u0001\u0002\u0001\u0002\u0001\u001d\u0001\u0d09\u0001\u04de\u0001\u02f1\u0005\u0001\u0005\u0013\u0001\u0000\u0001\u0000\u0001\u0001\u0001\u0000\u0007\u0004\u0001u\u0001\u0019\u0001a\u0001\u0012\u00018\u0001!\u0001\r\u0001\u0019\u0001%\u0001\u0011\u0001I\u0001\r\u0001\u0000\u0001\u001a\u0001i\u0001\r\u0001\u0011\u0001%\u0001B\u0001\b\u0001\u000b\u0001\u0007\u0001\u0005\u0001%\u0001\u0005\u0001*\u0001\u0004\u0001\u0011\u0001\u0003\u0001\u0017\u0001\u001d\u0001)\u0001\t\u0001+\u0001\u001b\u0001\r\u0001\t\u00012\u0001(\u0001\u0000\u0517_\u0003\u0007\u0003\u0017\u0001\u0007\u0001\u03b5\u0001\u18a2\u0001\b\u0001\u0007\u0003\u0000\u0001\u0003\u0001\u0000\u0001\u0003\u0116\u000b\u00013\u0001\u001f\u0001\\\u0001E\u0001\u0002\u0001%\u0001\u0003\u0001\t\u0001\u001d\u0001\u000e\u00015\u0001-\u0001C\u0001\u000e\u0001 \u0001 \u0001\u0017\u00a1\b\u033b\u1ece\u0001\u0000\u0013\u001a\u0001\u001b\u0001\u0007\u00015\u0001\u001b\u0001\u000b\u0001%\u0001\u0007\u00019\u0001S\u0001:\u0001\u0011\u0001\u001e\u0001\u0011\u0001\u001e\u0707\u2a00\u0001A\u0001\b\u0001\b\u0001\b\u0001\b\u0001\u0007\u0001%\u0001\r\u0001\u0013\u0001U\u0001\u0013\u0001\u001e\u00014\u0001\u0013\u0001\b\u0001?\u0001\u1e53\u00a7\b\u0001\u0012\u0001\f\u0001!\u0001\u0012\u0001O\u00012\u0001\u0012\u0001$\u0001\t\u0001\t\u00019\u0001\u0018\u0f77\u19ae\u0001\u0013\u0003\u0019\u0001\n\u0001\n\u0001\u0756\u0002\u0004\u0002\u1040\u0002\u0004\u0002\u0000\u001b\n\u0001\u000b\u0001\u0000\u0419\u099b\u0005\u0001\u0005\u001b\u0001\u001e\u0518\u05af\u024f\u05c6\u000f\u0db2\u06f5\u04ac\u0011\u0d5f\u0001\n\u0153\u02de5\u0001\u0005\u0000\u0221\u03da\u0001\u010f\u0001\f\u0083\u048f\u014f"
-
com.itextpdf.io.codec.brotli.dec.com.itextpdf.io.codec.brotli.dec.HuffmanModifier and TypeConstant FieldValue
static final int
1080
private static final int
15
-
com.itextpdf.io.codec.brotli.dec.com.itextpdf.io.codec.brotli.dec.RunningStateModifier and TypeConstant FieldValue
static final int
1
static final int
11
static final int
2
static final int
7
static final int
5
static final int
8
static final int
10
static final int
6
static final int
3
static final int
4
static final int
9
static final int
0
static final int
12
-
com.itextpdf.io.codec.brotli.dec.com.itextpdf.io.codec.brotli.dec.WordTransformTypeModifier and TypeConstant FieldValue
static final int
0
static final int
12
static final int
13
static final int
14
static final int
15
static final int
16
static final int
17
static final int
18
static final int
19
static final int
20
static final int
1
static final int
2
static final int
3
static final int
4
static final int
5
static final int
6
static final int
7
static final int
8
static final int
9
static final int
11
static final int
10
-
com.itextpdf.io.exceptions.IoExceptionMessageConstantModifier and TypeConstant FieldValue
public static final String
"All fill bits preceding eol code must be 0."
public static final String
"Already closed"
public static final String
"Bad endianness tag: 0x4949 or 0x4d4d."
public static final String
"Bad magic number. Should be 42."
public static final String
"{0} bit samples are not supported for horizontal differencing predictor."
public static final String
"Bits per component must be 1, 2, 4 or 8."
public static final String
"Bits per sample {0} is not supported."
public static final String
"Bmp image exception."
public static final String
"Woff2 brotli decoding exception"
public static final String
"Reading woff2 exception"
public static final String
"Bytes can be assigned to ByteArrayOutputStream only."
public static final String
"Bytes can be reset in ByteArrayOutputStream only."
public static final String
"Cannot find frame number {0} (zero-based)"
public static final String
"Cannot get TIFF image color."
public static final String
"Cannot handle box sizes higher than 2^32."
public static final String
"Cannot inflate TIFF image."
public static final String
"Cannot open output directory for <filename>"
public static final String
"Cannot read TIFF image."
public static final String
"Cannot write byte."
public static final String
"Cannot write bytes."
public static final String
"Cannot write float number."
public static final String
"Cannot write int number."
public static final String
"CCITT compression type must be CCITTG4, CCITTG3_1D or CCITTG3_2D."
public static final String
"Character code exception."
public static final String
"The CMap {0} was not found."
public static final String
"The color depth {0} is not supported."
public static final String
"The color space {0} is not supported."
public static final String
"ImageMagick comparison command is not specified. Set the ITEXT_MAGICK_COMPARE_EXEC environment variable with the CLI command which can run the ImageMagic comparison. See BUILDING.MD in the root of the repository for more details."
public static final String
"ImageMagick comparison command specified incorrectly. Set the ITEXT_MAGICK_COMPARE_EXEC environment variable with the CLI command which can run the ImageMagic comparison. See BUILDING.MD in the root of the repository for more details."
public static final String
"Components must be 1, 3 or 4."
public static final String
"Compression {0} is not supported."
public static final String
"Compression jpeg is only supported with a single strip. This image has {0} strips."
public static final String
"{0} corrupted jfif marker."
public static final String
"Directory number is too large."
public static final String
"Error during encoding the following code point: {0} in characterset: {1}"
public static final String
"EOL code word encountered in Black run."
public static final String
"EOL code word encountered in White run."
public static final String
"Error at file pointer {0}."
public static final String
"Error reading string."
public static final String
"Error with JP marker."
public static final String
"Expected FTYP marker."
public static final String
"Expected IHDR marker."
public static final String
"Expected JP marker."
public static final String
"Expected JP2H marker."
public static final String
"Expected trailing zero bits for byte-aligned lines"
public static final String
"Extra samples are not supported."
public static final String
"FDF startxref not found."
public static final String
"First scanline must be 1D encoded."
public static final String
"Font file {0} not found."
public static final String
"GhostScript failed for <filename>"
public static final String
"GIF image exception."
public static final String
"GIF signature not found."
public static final String
"Ghostscript command is not specified or specified incorrectly. Set the ITEXT_GS_EXEC environment variable to a CLI command that can run the Ghostscript application. See BUILDING.MD in the root of the repository for more details."
public static final String
"\'>\' not expected."
public static final String
"ICC profile contains {0} components, while the image data contains {1} components."
public static final String
"Illegal value for predictor in TIFF file."
public static final String
"Image format cannot be recognized."
public static final String
"Image is not a mask. You must call ImageData#makeMask()."
public static final String
"ImageMagick process output is null."
public static final String
"ImageMagick process execution finished with errors: "
public static final String
"Image mask cannot contain another image mask."
public static final String
"Incomplete palette."
public static final String
"Incorrect woff2 signature"
public static final String
"Invalid BMP file compression."
public static final String
"Invalid code encountered."
public static final String
"Invalid code encountered while decoding 2D group 3 compressed data."
public static final String
"Invalid code encountered while decoding 2D group 4 compressed data."
public static final String
"Invalid ICC profile."
public static final String
"Invalid JPEG2000 file."
public static final String
"Invalid magic value for bmp file. Must be \'BM\'"
public static final String
"{0} is not a valid TTC file."
public static final String
"Invalid WOFF font file."
public static final String
"Invalid WOFF2 font file."
public static final String
"I/O exception."
public static final String
"{0} is not a valid jpeg file."
public static final String
"{0} is not an afm or pfm font file."
public static final String
"JBIG2 image exception."
public static final String
"JPEG image exception."
public static final String
"JPEG2000 image exception."
public static final String
"woff2 loca table content size overflow exception"
public static final String
"Missing tag(s) for OJPEG compression"
public static final String
"{0} must have 8 bits per component."
public static final String
"N value {1} is not supported."
public static final String
"{0} is not a true type file"
public static final String
"{0} not found as file or resource."
public static final String
"This encoder only accepts BMP codepoints"
public static final String
"woff2 padding overflow exception"
public static final String
"Page number must be >= 1."
public static final String
"PDF \"%%EOF\" marker is not found."
public static final String
"PDF header not found."
public static final String
"PDF startxref not found."
public static final String
"Photometric {0} is not supported."
public static final String
"Planar images are not supported."
public static final String
"PNG image exception."
public static final String
"Premature EOF while reading JPEG."
public static final String
"Reading woff2 base 128 number exception"
public static final String
"Reading collection woff2 header exception"
public static final String
"Reading woff2 header exception"
public static final String
"Reading woff2 tables directory exception"
public static final String
"Reconstructing woff2 glyf table exception"
public static final String
"Reconstructing woff2 glyph exception"
public static final String
"Reconstructing woff2 hmtx table exception"
public static final String
"Reconstructing woff2 glyph\'s point exception"
public static final String
"Reconstructing woff2 table directory exception"
public static final String
"Scanline must begin with EOL code word."
public static final String
"Table {0} does not exist."
public static final String
"Table {0} does not exist in {1}"
public static final String
"This image can not be an image mask."
public static final String
"TIFF 5.0-style LZW codes are not supported."
public static final String
"TIFF_FILL_ORDER tag must be either 1 or 2."
public static final String
"TIFF image exception."
public static final String
"Tiles are not supported."
public static final String
"Transparency length must be equal to 2 with CCITT images"
public static final String
"TTC index doesn\'t exist in this TTC file."
public static final String
"Type of font is not recognized."
public static final String
"Type of font {0} is not recognized."
public static final String
"Unexpected close bracket."
public static final String
"Unexpected \'>>\'."
public static final String
"Unknown compression type {0}."
public static final String
"Unknown I/O exception."
public static final String
"Unknown PNG filter."
public static final String
"Unsupported box size == 0."
public static final String
"Unsupported encoding exception."
public static final String
"{0} unsupported jpeg marker {1}."
public static final String
"Writing woff2 exception"
-
com.itextpdf.io.font.CFFFontSubsetModifier and TypeConstant FieldValue
static final byte
0xe
static final byte
0xb
-
com.itextpdf.io.font.CjkResourceLoader
-
com.itextpdf.io.font.FontEncoding
-
com.itextpdf.io.font.FontProgramModifier and TypeConstant FieldValue
public static final int
1000
public static final int
100
public static final int
1000
-
com.itextpdf.io.font.com.itextpdf.io.font.OpenTypeParser
-
com.itextpdf.io.font.PdfEncodingsModifier and TypeConstant FieldValue
public static final String
"Cp1250"
public static final String
"Cp1252"
public static final String
"Cp1253"
public static final String
"Cp1257"
private static final String
""
public static final String
"Identity-H"
public static final String
"Identity-V"
public static final String
"MacRoman"
public static final String
"PDF"
public static final String
"Symbol"
public static final String
"UnicodeBig"
public static final String
"UnicodeBigUnmarked"
public static final String
"UTF-8"
public static final String
"Cp1252"
public static final String
"ZapfDingbats"
-
com.itextpdf.io.font.com.itextpdf.io.font.TrueTypeFontSubsetModifier and TypeConstant FieldValue
private static final int
1
private static final int
51
private static final int
32
private static final int
0
private static final int
2
private static final int
1
private static final int
8
private static final int
128
private static final int
64
-
com.itextpdf.io.font.com.itextpdf.io.font.Type1Parser
-
com.itextpdf.io.font.com.itextpdf.io.font.WoffConverter
-
com.itextpdf.io.font.cmap.CMapContentParser
-
com.itextpdf.io.font.cmap.CMapObjectModifier and TypeConstant FieldValue
protected static final int
6
protected static final int
7
protected static final int
2
protected static final int
5
protected static final int
3
protected static final int
4
protected static final int
1
protected static final int
8
-
com.itextpdf.io.font.cmap.CMapParserModifier and TypeConstant FieldValue
private static final String
"CMapName"
private static final String
"def"
private static final String
"endbfchar"
private static final String
"endbfrange"
private static final String
"endcidchar"
private static final String
"endcidrange"
private static final String
"endcodespacerange"
private static final int
10
private static final String
"Ordering"
private static final String
"Registry"
private static final String
"Supplement"
private static final String
"usecmap"
-
com.itextpdf.io.font.constants.FontMacStyleFlags
-
com.itextpdf.io.font.constants.FontResources
-
com.itextpdf.io.font.constants.FontStretchesModifier and TypeConstant FieldValue
public static final String
"Condensed"
public static final String
"Expanded"
public static final String
"ExtraCondensed"
public static final String
"ExtraExpanded"
private static final int
3
private static final int
7
private static final int
2
private static final int
8
private static final int
5
private static final int
4
private static final int
6
private static final int
1
private static final int
9
public static final String
"Normal"
public static final String
"SemiCondensed"
public static final String
"SemiExpanded"
public static final String
"UltraCondensed"
public static final String
"UltraExpanded"
-
com.itextpdf.io.font.constants.FontStylesModifier and TypeConstant FieldValue
public static final int
1
public static final int
3
public static final int
2
public static final int
0
public static final int
-1
-
com.itextpdf.io.font.constants.FontWeightsModifier and TypeConstant FieldValue
public static final int
900
public static final int
700
public static final int
800
public static final int
200
public static final int
300
public static final int
500
public static final int
400
public static final int
600
public static final int
100
-
com.itextpdf.io.font.constants.StandardFontFamilies
-
com.itextpdf.io.font.constants.StandardFontsModifier and TypeConstant FieldValue
public static final String
"Courier"
public static final String
"Courier-Bold"
public static final String
"Courier-BoldOblique"
public static final String
"Courier-Oblique"
public static final String
"Helvetica"
public static final String
"Helvetica-Bold"
public static final String
"Helvetica-BoldOblique"
public static final String
"Helvetica-Oblique"
public static final String
"Symbol"
public static final String
"Times-Bold"
public static final String
"Times-BoldItalic"
public static final String
"Times-Italic"
public static final String
"Times-Roman"
public static final String
"ZapfDingbats"
-
com.itextpdf.io.font.otf.Glyph
-
com.itextpdf.io.font.otf.LanguageTagsModifier and TypeConstant FieldValue
public static final String
"ARI "
public static final String
"ABA "
public static final String
"ABK "
public static final String
"ACR "
public static final String
"ACH "
public static final String
"ADY "
public static final String
"AFR "
public static final String
"AFK "
public static final String
"AGW "
public static final String
"AIO "
public static final String
"AKA "
public static final String
"SQI "
public static final String
"ALS "
public static final String
"ALT "
public static final String
"AMH "
public static final String
"ANG "
public static final String
"ARA "
public static final String
"ARG "
public static final String
"RKW "
public static final String
"HYE "
public static final String
"HYE0"
public static final String
"RUP "
public static final String
"FRP "
public static final String
"ASM "
public static final String
"AST "
public static final String
"ATH "
public static final String
"AVR "
public static final String
"AWA "
public static final String
"AYM "
public static final String
"AZE "
public static final String
"BAD "
public static final String
"BAG "
public static final String
"BGQ "
public static final String
"BLN "
public static final String
"BAN "
public static final String
"BAL "
public static final String
"BLT "
public static final String
"BLI "
public static final String
"BMB "
public static final String
"BML "
public static final String
"BAD0"
public static final String
"BDY "
public static final String
"BSH "
public static final String
"EUQ "
public static final String
"BTS "
public static final String
"BBC "
public static final String
"BAU "
public static final String
"BAR "
public static final String
"BEL "
public static final String
"BEM "
public static final String
"BCH "
public static final String
"BEN "
public static final String
"BBR "
public static final String
"BTI "
public static final String
"BHI "
public static final String
"BHO "
public static final String
"BCR "
public static final String
"BIK "
public static final String
"BIL "
public static final String
"BPY "
public static final String
"BIS "
public static final String
"BKF "
public static final String
"BRX "
public static final String
"BOS "
public static final String
"PCC "
public static final String
"BRH "
public static final String
"BRI "
public static final String
"BRE "
public static final String
"BUG "
public static final String
"BGR "
public static final String
"KJZ "
public static final String
"BRM "
public static final String
"BSK "
public static final String
"FRC "
public static final String
"CRR "
public static final String
"CAT "
public static final String
"CEB "
public static final String
"ESU "
public static final String
"CHG "
public static final String
"CHA "
public static final String
"CHH "
public static final String
"CHE "
public static final String
"CHR "
public static final String
"CHY "
public static final String
"CHI "
public static final String
"CGG "
public static final String
"QIN "
public static final String
"CCHN"
public static final String
"ZHH "
public static final String
"ZHP "
public static final String
"ZHS "
public static final String
"ZHT "
public static final String
"CHP "
public static final String
"CTG "
public static final String
"CHO "
public static final String
"CHK "
public static final String
"CSL "
public static final String
"CHK0"
public static final String
"CHU "
public static final String
"CMR "
public static final String
"COP "
public static final String
"COR "
public static final String
"COS "
public static final String
"CRE "
public static final String
"CPP "
public static final String
"CRT "
public static final String
"HRV "
public static final String
"CSY "
public static final String
"DNJ "
public static final String
"DNG "
public static final String
"DAN "
public static final String
"DAR "
public static final String
"DRI "
public static final String
"DAX "
public static final String
"TDD "
public static final String
"DHG "
public static final String
"DHV "
public static final String
"DUJ "
public static final String
"DIQ "
public static final String
"DNK "
public static final String
"DIV "
public static final String
"DJR0"
public static final String
"DGO "
public static final String
"DGR "
public static final String
"DUN "
public static final String
"NLD "
public static final String
"FLE "
public static final String
"DZN "
public static final String
"CJM "
public static final String
"ECR "
public static final String
"EMK "
public static final String
"KJP "
public static final String
"EBI "
public static final String
"EDO "
public static final String
"EFI "
public static final String
"ENG "
public static final String
"ERZ "
public static final String
"NTO "
public static final String
"ETI "
public static final String
"EVN "
public static final String
"EVK "
public static final String
"EWE "
public static final String
"FAN0"
public static final String
"FAT "
public static final String
"FOS "
public static final String
"FMP "
public static final String
"FJI "
public static final String
"PIL "
public static final String
"FIN "
public static final String
"FON "
public static final String
"FNE "
public static final String
"FRA "
public static final String
"FAN "
public static final String
"FRI "
public static final String
"FRL "
public static final String
"FUL "
public static final String
"FTA "
public static final String
"GAD "
public static final String
"GAG "
public static final String
"GAL "
public static final String
"LUG "
public static final String
"GAW "
public static final String
"GRO "
public static final String
"GAR "
public static final String
"GEZ "
public static final String
"KAT "
public static final String
"DEU "
public static final String
"GLK "
public static final String
"GIL "
public static final String
"GIH "
public static final String
"GOG "
public static final String
"GON "
public static final String
"ELL "
public static final String
"GRN "
public static final String
"GUA "
public static final String
"GUJ "
public static final String
"GNN "
public static final String
"GMZ "
public static final String
"GUF "
public static final String
"GUZ "
public static final String
"HAI "
public static final String
"HAL "
public static final String
"HBN "
public static final String
"HRI "
public static final String
"HAR "
public static final String
"BGC "
public static final String
"HAU "
public static final String
"HAW "
public static final String
"HAY "
public static final String
"HAZ "
public static final String
"IWR "
public static final String
"HER "
public static final String
"HMA "
public static final String
"HIL "
public static final String
"HIN "
public static final String
"HND "
public static final String
"HMO "
public static final String
"HMN "
public static final String
"MWW "
public static final String
"HO "
public static final String
"HUN "
public static final String
"IBA "
public static final String
"IBB "
public static final String
"ISL "
public static final String
"IDO "
public static final String
"IBO "
public static final String
"IJO "
public static final String
"ILO "
public static final String
"ISM "
public static final String
"IND "
public static final String
"ING "
public static final String
"INA "
public static final String
"ILE "
public static final String
"INU "
public static final String
"IPK "
public static final String
"IRI "
public static final String
"IRT "
public static final String
"ITA "
public static final String
"JAM "
public static final String
"JAN "
public static final String
"JAV "
public static final String
"JUL "
public static final String
"KAB "
public static final String
"KEA "
public static final String
"KAB0"
public static final String
"KAC "
public static final String
"KAL "
public static final String
"KLM "
public static final String
"KMB "
public static final String
"BJJ "
public static final String
"KAN "
public static final String
"KNR "
public static final String
"CAK "
public static final String
"KAR "
public static final String
"KRM "
public static final String
"KRK "
public static final String
"KRL "
public static final String
"KRN "
public static final String
"KSH "
public static final String
"CSB "
public static final String
"KAZ "
public static final String
"KEB "
public static final String
"KEK "
public static final String
"KHA "
public static final String
"KHT "
public static final String
"KHK "
public static final String
"KHS "
public static final String
"KHV "
public static final String
"KSI "
public static final String
"XKF "
public static final String
"KHM "
public static final String
"KMZ "
public static final String
"KHW "
public static final String
"KGE "
public static final String
"QUC "
public static final String
"KON "
public static final String
"KIK "
public static final String
"KSM "
public static final String
"RUA "
public static final String
"KIR "
public static final String
"GIL0"
public static final String
"KIU "
public static final String
"KIS "
public static final String
"MKW "
public static final String
"KOD "
public static final String
"KKN "
public static final String
"KOM "
public static final String
"KOP "
public static final String
"KOZ "
public static final String
"KMO "
public static final String
"KMS "
public static final String
"KON0"
public static final String
"KOK "
public static final String
"KRT "
public static final String
"KOR "
public static final String
"KOH "
public static final String
"KYK "
public static final String
"KOS "
public static final String
"KPL "
public static final String
"GKP "
public static final String
"XPE "
public static final String
"KRI "
public static final String
"JCT "
public static final String
"KUA "
public static final String
"KUI "
public static final String
"KUL "
public static final String
"KMN "
public static final String
"KUM "
public static final String
"KUR "
public static final String
"KUU "
public static final String
"KUY "
public static final String
"LCR "
public static final String
"LDK "
public static final String
"LAD "
public static final String
"JUD "
public static final String
"LAH "
public static final String
"LAK "
public static final String
"LKI "
public static final String
"LAM "
public static final String
"LJP "
public static final String
"LAO "
public static final String
"LAT "
public static final String
"LVI "
public static final String
"LAZ "
public static final String
"LEZ "
public static final String
"LIJ "
public static final String
"LMB "
public static final String
"LIM "
public static final String
"LIN "
public static final String
"LIS "
public static final String
"LTH "
public static final String
"JBO "
public static final String
"LOM "
public static final String
"LMO "
public static final String
"LMW "
public static final String
"LMA "
public static final String
"NDS "
public static final String
"LSB "
public static final String
"XBD "
public static final String
"LUB "
public static final String
"LUA "
public static final String
"LSM "
public static final String
"LUO "
public static final String
"LRC "
public static final String
"LTZ "
public static final String
"LUH "
public static final String
"MKD "
public static final String
"MAD "
public static final String
"MAG "
public static final String
"MTH "
public static final String
"MAJ "
public static final String
"MKR "
public static final String
"MAK "
public static final String
"KDE "
public static final String
"MLG "
public static final String
"MLY "
public static final String
"MAL "
public static final String
"MLR "
public static final String
"MLE "
public static final String
"MLN "
public static final String
"MTS "
public static final String
"MAM "
public static final String
"MCH "
public static final String
"MDR "
public static final String
"MND "
public static final String
"MNK "
public static final String
"MNI "
public static final String
"MAN "
public static final String
"MNX "
public static final String
"MRI "
public static final String
"MAP "
public static final String
"MAR "
public static final String
"MAH "
public static final String
"MAW "
public static final String
"MYN "
public static final String
"MZN "
public static final String
"NZA "
public static final String
"MBO "
public static final String
"MBN "
public static final String
"BYV "
public static final String
"MEN "
public static final String
"MDE "
public static final String
"MER "
public static final String
"WTM "
public static final String
"MIN "
public static final String
"XJB "
public static final String
"MWL "
public static final String
"MIZ "
public static final String
"MOH "
public static final String
"MOK "
public static final String
"MOL "
public static final String
"MON "
public static final String
"MNG "
public static final String
"MCR "
public static final String
"MFE "
public static final String
"MOR "
public static final String
"MOS "
public static final String
"MUN "
public static final String
"MUS "
public static final String
"NCR "
public static final String
"NAG "
public static final String
"NGR "
public static final String
"NAH "
public static final String
"NAN "
public static final String
"NAS "
public static final String
"NAU "
public static final String
"NAV "
public static final String
"NDC "
public static final String
"NDB "
public static final String
"NDG "
public static final String
"NAP "
public static final String
"NEP "
public static final String
"NEW "
public static final String
"NGA "
public static final String
"FUV "
public static final String
"NOE "
public static final String
"NIS "
public static final String
"NIU "
public static final String
"NKO "
public static final String
"NOG "
public static final String
"PIH "
public static final String
"SCS "
public static final String
"NSM "
public static final String
"NTA "
public static final String
"NHC "
public static final String
"NOR "
public static final String
"NYN "
public static final String
"NOV "
public static final String
"NYM "
public static final String
"NKL "
public static final String
"OCI "
public static final String
"ORI "
public static final String
"OCR "
public static final String
"OJB "
public static final String
"SGA "
public static final String
"ORO "
public static final String
"OSS "
public static final String
"PAU "
public static final String
"PLG "
public static final String
"PAA "
public static final String
"PAL "
public static final String
"PAP "
public static final String
"PAM "
public static final String
"PAG "
public static final String
"BLK "
public static final String
"PAP0"
public static final String
"PAS "
public static final String
"MFA "
public static final String
"PDC "
public static final String
"FAR "
public static final String
"PHK "
public static final String
"APPH"
public static final String
"IPPH"
public static final String
"PCD "
public static final String
"PMS "
public static final String
"POH "
public static final String
"PON "
public static final String
"PLK "
public static final String
"PGR "
public static final String
"PTG "
public static final String
"PRO "
public static final String
"PAN "
public static final String
"QUZ "
public static final String
"QUH "
public static final String
"QVI "
public static final String
"QWH "
public static final String
"RCR "
public static final String
"RAJ "
public static final String
"ARK "
public static final String
"RAR "
public static final String
"REJ "
public static final String
"RIA "
public static final String
"KSH0"
public static final String
"RIT "
public static final String
"ROM "
public static final String
"RMS "
public static final String
"ROY "
public static final String
"RTM "
public static final String
"RUN "
public static final String
"RUS "
public static final String
"RBU "
public static final String
"RSY "
public static final String
"SAD "
public static final String
"YAK "
public static final String
"SMO "
public static final String
"SGS "
public static final String
"CUK "
public static final String
"SGO "
public static final String
"SAN "
public static final String
"SAT "
public static final String
"SRK "
public static final String
"SRD "
public static final String
"SAS "
public static final String
"STQ "
public static final String
"SAY "
public static final String
"SCO "
public static final String
"GAE "
public static final String
"SEK "
public static final String
"SEL "
public static final String
"SNA "
public static final String
"SRB "
public static final String
"SRR "
public static final String
"KSW "
public static final String
"SHN "
public static final String
"SNA0"
public static final String
"SIB "
public static final String
"SCN "
public static final String
"SID "
public static final String
"SZL "
public static final String
"SIG "
public static final String
"SND "
public static final String
"SNH "
public static final String
"SKS "
public static final String
"SLA "
public static final String
"SKY "
public static final String
"SLV "
public static final String
"SOG "
public static final String
"XOG "
public static final String
"SML "
public static final String
"SOP "
public static final String
"SNK "
public static final String
"NSO "
public static final String
"SOT "
public static final String
"SSL "
public static final String
"KJD "
public static final String
"SSM "
public static final String
"ESP "
public static final String
"ZGH "
public static final String
"SUK "
public static final String
"SUN "
public static final String
"SUR "
public static final String
"SXT "
public static final String
"SVA "
public static final String
"SWA "
public static final String
"SWK "
public static final String
"SWZ "
public static final String
"SVE "
public static final String
"SYL "
public static final String
"SYR "
public static final String
"SYRN"
public static final String
"SYRE"
public static final String
"SYRJ"
public static final String
"TAB "
public static final String
"SHI "
public static final String
"TGL "
public static final String
"THT "
public static final String
"TAJ "
public static final String
"TMH "
public static final String
"TZM "
public static final String
"TAM "
public static final String
"RIF "
public static final String
"TAT "
public static final String
"TYZ "
public static final String
"TEL "
public static final String
"TMN "
public static final String
"TET "
public static final String
"TCR "
public static final String
"THA "
public static final String
"TIB "
public static final String
"TGR "
public static final String
"TGY "
public static final String
"TIV "
public static final String
"TOD "
public static final String
"TPI "
public static final String
"TOD0"
public static final String
"TNG "
public static final String
"TGN "
public static final String
"AZB "
public static final String
"TSJ "
public static final String
"TSG "
public static final String
"TNA "
public static final String
"TUM "
public static final String
"TUL "
public static final String
"TNE "
public static final String
"TRK "
public static final String
"TKM "
public static final String
"TUA "
public static final String
"TVL "
public static final String
"TUV "
public static final String
"TWI "
public static final String
"TZO "
public static final String
"UDM "
public static final String
"UKR "
public static final String
"UMB "
public static final String
"SXU "
public static final String
"USB "
public static final String
"URD "
public static final String
"UYG "
public static final String
"UZB "
public static final String
"VEN "
public static final String
"VEC "
public static final String
"VIT "
public static final String
"RMY "
public static final String
"VOL "
public static final String
"VRO "
public static final String
"WA "
public static final String
"WAG "
public static final String
"WLN "
public static final String
"WAR "
public static final String
"GUC "
public static final String
"WEL "
public static final String
"WCR "
public static final String
"CJA "
public static final String
"KYU "
public static final String
"PNB "
public static final String
"PWO "
public static final String
"WLF "
public static final String
"DCR "
public static final String
"XHS "
public static final String
"YCR "
public static final String
"YAO "
public static final String
"YAP "
public static final String
"YIC "
public static final String
"YIM "
public static final String
"JII "
public static final String
"YBA "
public static final String
"CBK "
public static final String
"ZND "
public static final String
"DJR "
public static final String
"ZZA "
public static final String
"ZEA "
public static final String
"ZHA "
public static final String
"ZUL "
-
com.itextpdf.io.font.otf.OpenTypeGdefTableReaderModifier and TypeConstant FieldValue
static final int
2
static final int
4
static final int
8
-
com.itextpdf.io.font.otf.OpenTypeScript
-
com.itextpdf.io.font.otf.OtfClassModifier and TypeConstant FieldValue
public static final int
1
public static final int
2
public static final int
3
-
com.itextpdf.io.font.otf.lookuptype8.PosTableLookup8Format1.PosRuleFormat1Modifier and TypeConstant FieldValue
private static final long
2777822503157518715L
-
com.itextpdf.io.font.otf.lookuptype8.PosTableLookup8Format2.PosRuleFormat2Modifier and TypeConstant FieldValue
private static final long
8583758144617770335L
-
com.itextpdf.io.font.woff2.com.itextpdf.io.font.woff2.TableTagsModifier and TypeConstant FieldValue
public static final int
1128678944
public static final int
1146308935
public static final int
1735162214
public static final int
1751474532
public static final int
1751672161
public static final int
1752003704
public static final int
1819239265
public static final int
1835104368
-
com.itextpdf.io.font.woff2.com.itextpdf.io.font.woff2.Woff2CommonModifier and TypeConstant FieldValue
public static final int
16
public static final int
12
public static final int
1953784678
public static final int
256
public static final int
2001684018
-
com.itextpdf.io.font.woff2.com.itextpdf.io.font.woff2.Woff2DecModifier and TypeConstant FieldValue
private static final int
1
private static final int
32
private static final int
8
private static final int
128
private static final int
64
private static final int
256
private static final int
5120
private static final int
10
private static final int
1
private static final int
8
private static final int
16
private static final int
32
private static final int
2
private static final int
4
private static final float
100.0f
-
com.itextpdf.io.image.com.itextpdf.io.image.BmpImageHelperModifier and TypeConstant FieldValue
private static final int
3
private static final int
0
private static final int
2
private static final int
1
private static final int
0
private static final int
2
private static final int
1
private static final int
0
private static final int
3
private static final int
1
private static final int
2
private static final int
4
private static final int
7
private static final int
5
private static final int
6
private static final int
8
private static final int
9
private static final int
10
private static final int
13
private static final int
14
private static final int
15
private static final int
11
private static final int
12
-
com.itextpdf.io.image.GifImageHelper
-
com.itextpdf.io.image.com.itextpdf.io.image.Jpeg2000ImageHelperModifier and TypeConstant FieldValue
private static final int
1651532643
private static final int
1668246642
private static final int
1685348972
private static final int
1718909296
private static final int
1768449138
private static final int
1783636000
private static final int
1785737760
private static final int
1785737827
private static final int
1785737832
private static final int
1970433056
private static final int
1785751920
private static final int
1785755746
-
com.itextpdf.io.image.com.itextpdf.io.image.JpegImageHelperModifier and TypeConstant FieldValue
private static final int
224
private static final int
226
private static final int
237
private static final int
238
private static final int
2
private static final int
-1
private static final int
1
private static final int
0
-
com.itextpdf.io.image.com.itextpdf.io.image.PngImageHelperModifier and TypeConstant FieldValue
public static final String
"cHRM"
public static final String
"gAMA"
public static final String
"iCCP"
public static final String
"IDAT"
public static final String
"IEND"
public static final String
"IHDR"
public static final String
"pHYs"
public static final String
"PLTE"
private static final int
3
private static final int
0
private static final int
4
private static final int
1
private static final int
2
public static final String
"sRGB"
private static final int
4096
public static final String
"tRNS"
-
com.itextpdf.io.image.PngImageHelperConstantsModifier and TypeConstant FieldValue
public static final String
"/AbsoluteColormetric"
public static final String
"BitsPerComponent"
public static final String
"Colors"
public static final String
"Columns"
public static final String
"Intent"
public static final String
"Mask"
public static final String
"/Perceptual"
public static final String
"Predictor"
public static final String
"/RelativeColorimetric"
public static final String
"/Saturation"
-
com.itextpdf.io.image.RawImageDataModifier and TypeConstant FieldValue
public static final int
1
public static final int
2
public static final int
8
public static final int
4
public static final int
257
public static final int
258
public static final int
256
-
com.itextpdf.io.logs.IoLogMessageConstantModifier and TypeConstant FieldValue
public static final String
"Action was set for a link annotation containing destination. The old destination will be cleared."
public static final String
"An attempt is made to free already flushed indirect object reference. Indirect reference wasn\'t freed."
public static final String
"A layout tagging hint for which an actual tag was already created in tags structure is marked as artifact. Existing tag will be left in the tags tree."
public static final String
"For associated files their associated file specification dictionaries shall include the AFRelationship key."
public static final String
"Attempt to process NaN in PdfNumber or when writing to PDF. Zero value will be used as a fallback."
public static final String
"Attempt to create a tag for a hint which is already marked as finished, tag will not be created."
public static final String
"Attempt to generate PDF pages tree without any pages, so a new page will be added."
public static final String
"An attempt is made to move the tag tree pointer to the tag parent which has been already flushed. Tag tree pointer is moved to the root tag instead."
public static final String
"Layout tagging hints addition failed: cannot add a hint that is already marked as finished. Consider using com.itextpdf.layout.tagging.LayoutTaggingHelper#moveKidHint method for moving already finished kid hint from not yet finished parent hint."
public static final String
"Layout tagging hints addition failed: cannot add new kid hints to a parent which hint is already marked as finished. Consider using com.itextpdf.layout.tagging.LayoutTaggingHelper#replaceKidHint method for replacing not yet finished kid hint of a finished parent hint."
public static final String
"Layout tagging hints modification failed: cannot move kid hint for which both itself and it\'s parent are already marked as finished."
public static final String
"Layout tagging hints modification failed: cannot move kid hint to a parent that is already marked as finished."
public static final String
"Layout tagging hints modification failed: cannot replace a kid hint that is already marked as finished."
public static final String
"Cannot resolve \"{0}\" role in {1} namespace mapping to standard role, because of the too much transitive mappings."
public static final String
"Cannot resolve \"{0}\" role mapping to standard role, because of the too much transitive mappings."
public static final String
"Canvas is already full. Element will be skipped."
public static final String
"The direction for this character has not been detected: code point {0}. The Other Neutrals algorithm will be used."
public static final String
"Element content was clipped because some height properties are set."
public static final String
"Collection dictionary already exists. It will be modified."
public static final String
"Alpha channel {0} was ignored during color creation. Note that opacity can be achieved in some places by using \'setOpacity\' method or \'TransparentColor\' class"
public static final String
"Color \"{0}\" was not parsed. It has invalid value. Defaulting to black color."
public static final String
"Some of colorant intensities are invalid: they are bigger than 1 or less than 0. We will force them to become 1 or 0 respectively."
public static final String
"The Comb flag may be set only if the MaxLen entry is present in the text field dictionary and if the Multiline, Password, and FileSelect flags are clear."
public static final String
"Could not find glyph with the following code: {0}"
public static final String
"While processing an instance of TextRenderer, iText uses createCopy() to create glyph lines of specific fonts, which represent its parts. So if one extends TextRenderer, one should override createCopy, otherwise if FontSelector related logic is triggered, copies of this TextRenderer will have the default behavior rather than the custom one."
public static final String
"Created root tag has role mapping: \"/Document\" role{0} is mapped{1}. Resulting tag structure might have invalid root tag."
public static final String
"Destinations are not permitted for link annotations that already have actions. The old action will be removed."
public static final String
"DirectOnly object cannot be indirect"
public static final String
"Document Font has illegal differences array. Entry {0} references a glyph ID over 255 and will be ignored."
public static final String
"The document already has field {0}. Annotations of the fields with this name will be added to the existing one as children. If you want to have separate fields, please, rename them manually before copying."
public static final String
"Document has conflicting names for optional content groups. Groups with conflicting names will be renamed"
public static final String
"The document original and/or modified id is corrupted"
public static final String
"The document version specified in catalog is corrupted"
public static final String
"During the construction of the ICC profile, the {0} error with message \"{1}\" occurred, the ICC profile will not be installed in the image."
public static final String
"Element was placed in a forced way. Keep with next property will be ignored"
public static final String
"No destination in the target was specified for action. Destination entry is mandatory for embedded go-to actions."
public static final String
"Corrupted tag structure: encountered invalid marked content reference - it doesn\'t refer to any page or any mcid. This content reference will be ignored."
public static final String
"Encrypted payload file spec shall have \'AFRelationship\' filed equal to \'EncryptedPayload\'"
public static final String
"Encryption dictionary entries P and EncryptMetadata have value that does not correspond to encrypted values in Perms key."
public static final String
"Exception while creating default font (Helvetica, WinAnsi)"
public static final String
"Exception while updating XmpMetadata"
public static final String
"Existing tag structure of the document has a root of \"{0}\" role in \"{1}\" namespace that is not mapped to the standard role."
public static final String
"Failed to determine CIDFont subtype. The type of CIDFont shall be CIDFontType0 or CIDFontType2."
public static final String
"Failed to parse encoding stream."
public static final String
"Failed to process a transformation matrix which is noninvertible. Some content may be placed not as expected."
public static final String
"Value \"{0}\" is not contained in /Opt array of field \"{1}\"."
public static final String
"Closing of the file channel this source is based on failed."
public static final String
"{0} {1} R stream object filter was already flushed, stream compression will remain as in original file. Try to flush object containing filter before the PdfDocument#close() method so that stream compression would be processed as intended."
public static final String
"Flex item layout result isn\'t full, but it must be. The cross size of the flex item will be 0."
public static final String
"Flushed object contains indirect reference which is free. Null object will be written instead."
public static final String
"Flushed object contains indirect reference which doesn\'t refer to any other object. Null object will be written instead."
public static final String
"Font dictionary does not contain required /FontDescriptor entry."
public static final String
"Font dictionary does not contain required /Widths entry."
public static final String
"Font {0} has invalid glyph: {1}"
public static final String
"The \"Property.FONT\" property must be a PdfFont object in this context."
public static final String
"Font subset issue. Full font will be embedded."
public static final String
"ForbidRelease flag is set and release is called. Releasing will not be performed."
public static final String
"If a renderer overflows, iText uses this method to create another renderer for the overflow part. So if one wants to extend the renderer, one should override this method: otherwise the default method will be used and thus the default rather than the custom renderer will be created."
public static final String
"Subtable format {0} of GPOS Lookup Type {1} is not supported yet"
public static final String
"Graphics state is always deleted after event dispatching. If you want to preserve it in renderer info, use preserveGraphicsState method after receiving renderer info."
public static final String
"If Path key is set, Vertices key shall not be present. Remove Vertices key before setting Path"
public static final String
"The image cannot be auto scaled and scaled by a certain parameter simultaneously"
public static final String
"Image has icc profile with incompatible number of color components compared to base color space in image indexed color space. The icc profile will be ignored."
public static final String
"Image has icc profile with incompatible number of color components compared to image color space. The icc profile will be ignored."
public static final String
IMAGE_HAS_INCORRECT_OR_UNSUPPORTED_BASE_COLOR_SPACE_IN_INDEXED_COLOR_SPACE_OVERRIDDEN_BY_ICC_PROFILE
"Image has incorrect or unsupported base color space in indexed color space, it will be overridden by one based on embedded icc profile."
public static final String
"Image has incorrect or unsupported color space, that will be overridden by one based on embedded icc profile."
public static final String
"Image cannot be inline if it has JBIG2Decode filter. It will be added as an ImageXObject"
public static final String
"Image cannot be inline if it has JPXDecode filter. It will be added as an ImageXObject"
public static final String
"Image cannot be inline if it has a Mask"
public static final String
"Inline image size cannot be more than 4KB. It will be added as an ImageXObject"
public static final String
"An attempt is made to free an indirect reference which was already used in the flushed object. Indirect reference wasn\'t freed."
public static final String
"Inline block element does not fit into parent element and will be clipped"
public static final String
"When destination\'s not associated with a Remote or Embedded Go-To action, it shall specify page dictionary instead of page number. Otherwise destination might be considered invalid"
public static final String
"Skipped CRL: {0}"
public static final String
"Invalid indirect reference {0} {1} R"
public static final String
"Invalid key value: key {0} has null value."
public static final String
"Last row is not completed. Table bottom border may collapse as you do not expect it"
public static final String
"Make copy of Catalog dictionary is forbidden."
public static final String
"Existing mapping for {0} in {1} namespace was overwritten."
public static final String
"Existing mapping for {0} in structure tree root role map was {1} and it was overwritten with {2}."
public static final String
"Method {0} is not implemented by default: please, override and implement it. {1} will be used instead."
public static final String
"Multiple values were set to a field that does not have MultiSelect flag set."
public static final String
"Name \"{0}\" already exists in the name tree; old value will be replaced by the new one."
public static final String
"Not tagged pages are copied to the tagged document. Destination document now may contain not tagged content."
public static final String
"Number tree ends with a key which is invalid according to the PDF specification."
public static final String
"Occupied area has not been initialized. {0}"
public static final String
"OCG copying caused the following exception: {0}."
public static final String
"OCSP status is revoked."
public static final String
"OCSP status is unknown."
public static final String
"Closing of one of the grouped sources failed."
public static final String
"OpenType GDEF table error: {0}"
public static final String
"Orphans constraint violated for paragraph split at page {0}. Min number of orphans: {1}; actual: {2}. \nComment: {3}"
public static final String
"Outline destination page number {0} is out of bounds"
public static final String
"Page tree is broken. Failed to retrieve page number {0}. Null will be returned."
public static final String
"Page was flushed. {0} will not be performed."
public static final String
"The page passed to Canvas#enableAutoTagging(PdfPage) method shall be the one on which this canvas will be rendered. However the actual passed PdfPage instance sets not such page. This might lead to creation of malformed PDF document."
public static final String
"Path key is present. Vertices will be ignored"
public static final String
"PdfObject flushing is not performed: PdfDocument is opened in append mode and the object is not marked as modified ( see PdfObject#setModified() )."
public static final String
"PdfReader closing failed due to the error occurred!"
public static final String
"The PDF contains a BDC operator which refers to a not existing Property dictionary: {0}."
public static final String
"PdfWriter closing failed due to the error occurred!"
public static final String
"Png image has color profile with incompatible number of color components."
public static final String
"Popup entry in the markup annotations refers not to the annotation with Popup subtype."
public static final String
"Premature call of handleViolation method."
public static final String
"Property {0} in percents is not supported"
public static final String
"The {0} rectangle has negative or zero sizes. It will not be displayed."
public static final String
"The {0} rectangle has negative size. It will not be displayed."
public static final String
"The page requested to be removed has already been flushed."
public static final String
"The renderer was not able to process keep with next property properly"
public static final String
"Role mapping \"{0}\" from source document is not copied. Destination document already has \"{1}\" mapping."
public static final String
"Role mapping for \"{0}\" from source document is not copied. Mapping to namespace is in an invalid form (should be [PdfName, PdfDictionary])."
public static final String
"Rotation was not correctly processed for {0}"
public static final String
"Some fields in target dictionary are not set or incorrect. Null will be returned."
public static final String
"Source document has AcroForm dictionary. The pages you are going to copy may have FormFields, but they will not be copied, because you have not used any IPdfPageExtraCopier"
public static final String
"Start marker is missing in the pfb file"
public static final String
"StandardScriptConfig class is designed for only standard scripts, otherwise it might be incompatible."
public static final String
"Structure destinations shall specify structure element ID in remote go-to actions. Structure element has been replaced with its ID in the structure destination"
public static final String
"Sum of table columns is greater than 100%."
public static final String
"Table width is more than expected due to min width of cell(s)."
public static final String
"Tag structure initialization failed, tag structure is ignored, it might be corrupted."
public static final String
"ToUnicode CMap more than 2 bytes not supported."
public static final String
"Type 3 font cannot be added to FontSet. Custom FontProvider class may be created for this purpose."
public static final String
"Type 3 font issue. Font cannot be initialized correctly."
public static final String
"Type 3 font issue. Font Descriptor is required for tagged PDF. FontName shall be specified."
public static final String
"Cannot find pdfCalligraph module, which was implicitly required by one of the layout properties"
public static final String
"Unable to apply page dependent property, because the page on which element is drawn is unknown. Usually this means that element was added to the Canvas instance that was created not with constructor taking PdfPage as argument. Not processed property: {0}"
public static final String
"Unable to invert gradient transformation, ignoring it"
public static final String
"Unexpected behaviour during table row collapsing. Calculated rowspan was less then 1."
public static final String
"Unexpected exception encountered in service thread. Shutting it down."
public static final String
"Unknown CMap {0}"
public static final String
"Unknown color format: must be rgb or rrggbb."
public static final String
"Unknown error while processing CMap."
public static final String
"\"{0}\" entry in the \"{1}\" dictionary is a {2} and higher version feature. It is meaningless for the current {3} version."
public static final String
"Widows constraint violated for paragraph split at page {0}. Min number of widows: {1}; actual: {2}.\nComment: {3}"
public static final String
"Writer encryption will be ignored, because append mode is used. Document will preserve the original encryption (or will stay unencrypted)"
public static final String
"Writer encryption will be ignored, because preservation of encryption is enabled. Document will preserve the original encryption (or will stay unencrypted)"
public static final String
"Wrong media box size: {0}. The arguments beyond the 4th will be ignored"
public static final String
"Xfdf annotation \"{0}\" is not supported"
public static final String
"Xfdf href attribute and pdf document name are different!"
public static final String
"Xfdf no f object to compare."
public static final String
"Xfdf no such field in pdf document!"
public static final String
"Xfdf unsupported attribute type"
public static final String
"XObject has no StructParents entry in its stream, no entry in ParentTree will be created for the corresponding structure elements"
public static final String
"Error occurred while reading cross reference table. Cross reference table will be rebuilt."
-
com.itextpdf.io.source.com.itextpdf.io.source.PagedChannelRandomAccessSourceModifier and TypeConstant FieldValue
public static final int
16
public static final int
67108864
-
com.itextpdf.io.util.GhostscriptHelperModifier and TypeConstant FieldValue
public static final String
"ITEXT_GS_EXEC"
static final String
"gsExec"
static final String
"GPL Ghostscript"
private static final String
" -dSAFER -dNOPAUSE -dBATCH -sDEVICE=png16m -r150 {0} -sOutputFile=\"{1}\" \"{2}\""
private static final String
"%03d"
private static final String
"png"
private static final String
"itext_gs_io_temp"
-
com.itextpdf.io.util.HashCode
-
com.itextpdf.io.util.ImageMagickHelper
-
com.itextpdf.io.util.StreamUtil
-
com.itextpdf.kernel.actions.data.ITextCoreProductData
-
com.itextpdf.kernel.actions.events.ITextCoreProductEvent
-
com.itextpdf.kernel.colors.WebColorsModifier and TypeConstant FieldValue
private static final double
255.0
private static final long
6350366251375926010L
-
com.itextpdf.kernel.colors.gradients.AbstractLinearGradientBuilder
-
com.itextpdf.kernel.crypto.AESCipher
-
com.itextpdf.kernel.crypto.AESCipherCBCnoPad
-
com.itextpdf.kernel.crypto.securityhandler.com.itextpdf.kernel.crypto.securityhandler.EncryptionUtils
-
com.itextpdf.kernel.crypto.securityhandler.PubKeySecurityHandlerModifier and TypeConstant FieldValue
private static final int
40
private static final int
20
-
com.itextpdf.kernel.crypto.securityhandler.StandardHandlerUsingAes256Modifier and TypeConstant FieldValue
private static final int
40
private static final int
8
private static final int
32
-
com.itextpdf.kernel.crypto.securityhandler.StandardHandlerUsingStandard40
-
com.itextpdf.kernel.crypto.securityhandler.StandardSecurityHandlerModifier and TypeConstant FieldValue
protected static final int
-64
protected static final int
-3904
protected static final int
-4
-
com.itextpdf.kernel.events.PdfDocumentEvent
-
com.itextpdf.kernel.exceptions.BadPasswordExceptionModifier and TypeConstant FieldValue
public static final String
"PdfReader is not opened with owner password"
-
com.itextpdf.kernel.exceptions.KernelExceptionMessageConstantModifier and TypeConstant FieldValue
public static final String
"Algorithm {0} is not supported."
public static final String
"Amount of bytes in the PDF document cannot be less than zero"
public static final String
"Annotation shall have reference to page."
public static final String
"Append mode requires a document without errors, even if recovery is possible."
public static final String
"{0} should not be null."
public static final String
"Bad public key certificate and/or private key."
public static final String
"Password hash exceeds 48 bytes and extra bytes are not 0"
public static final String
"Bad user password. Password is not provided or wrong password provided. Correct password should be passed to PdfReader constructor with properties. See ReaderProperties#setPassword() method."
public static final String
"Cannot add kid to the flushed element."
public static final String
"{0} cannot be embedded due to licensing restrictions."
public static final String
"Cannot close document."
public static final String
"Cannot close document with already flushed PDF Catalog."
public static final String
"Cannot convert PdfArray to an array of booleans"
public static final String
"Cannot convert PdfArray to an array of doubles."
public static final String
"Cannot convert PdfArray to an array of floats."
public static final String
"Cannot convert PdfArray to an array of integers."
public static final String
"Cannot convert PdfArray to an array of longs."
public static final String
"Cannot convert PdfArray to Rectangle."
public static final String
"Cannot copy flushed object."
public static final String
"Cannot copy flushed tag."
public static final String
"Cannot copy indirect object from the document that is being written."
public static final String
"Cannot copy object content."
public static final String
"Cannot copy to document opened in reading mode."
public static final String
"Cannot create font from null pdf dictionary."
public static final String
"Cannot create PdfImageXObject instance by WmfImage. Use PdfFormXObject constructor instead."
public static final String
"Cannot create pdfstream by InputStream without PdfDocument."
public static final String
"Cannot create Type0 font with true type font program without embedding it."
public static final String
"Standard fonts cannot be embedded."
public static final String
"Cannot embed Type0 font with CID font program based on non-generic predefined CMap."
public static final String
"Cannot find image data or EI."
public static final String
"Cannot flush document root tag before document is closed."
public static final String
"Cannot flush object."
public static final String
"Cannot get content bytes."
public static final String
"Cannot get PdfStream bytes."
public static final String
"Cannot move flushed tag"
public static final String
"Cannot move pages in partly flushed document. Page number {0} is already flushed."
public static final String
"Cannot move to flushed kid."
public static final String
"Cannot move to marked content reference."
public static final String
"Cannot move to parent current element is root."
public static final String
"Cannot open document."
public static final String
"Cannot operate with the flushed PdfStream."
public static final String
"Cannot parse content stream."
public static final String
"Cannot read a stream in order to append new bytes."
public static final String
"Cannot read PdfObject."
public static final String
"Cannot recognise document font {0} with {1} encoding"
public static final String
"Cannot relocate root tag."
public static final String
"Cannot relocate tag which is already flushed."
public static final String
"Cannot relocate tag which parent is already flushed."
public static final String
"Cannot remove document root tag."
public static final String
"Cannot remove marked content reference, because its page has been already flushed."
public static final String
"Cannot remove tag, because its parent is flushed."
public static final String
"Invalid PDF. There is no media box attribute for page or its parents."
public static final String
"Cannot set data to PdfStream which was created by InputStream."
public static final String
"Cannot set encrypted payload to a document opened in read only mode."
public static final String
"Cannot set encrypted payload to an encrypted document."
public static final String
"Cannot split document that is being written."
public static final String
"Cannot write object after it was released. In normal situation the object must be read once again before being written."
public static final String
"Cannot write to PdfStream."
public static final String
"Certificate is not provided. Document is encrypted with public key certificate, it should be passed to PdfReader constructor with properties. See ReaderProperties#setPublicKeySecurityParams() method."
public static final String
"/CF not found (encryption)"
public static final String
"ColorSpace not found."
public static final String
"Content stream must not invoke operators that specify colors or other color related parameters in the graphics state."
public static final String
"Document outline dictionary is corrupted: some outline (PDF object: \"{0}\") has wrong first/next link entry."
public static final String
"Document outline is corrupted: some outline (PDF object: \"{0}\") lacks the required parent entry."
public static final String
"Document outline is corrupted: some outline (PDF object: \"{0}\") lacks the required title entry."
public static final String
"The trailer is corrupted: the catalog is corrupted or cannot be referenced from the file\'s trailer. The PDF cannot be opened."
public static final String
"Data handler counter has been disabled"
public static final String
"/DefaultCryptFilter not found (encryption)."
public static final String
"Dictionary doesn\'t have supported font data."
public static final String
"Document was closed. It is impossible to execute action."
public static final String
"Document doesn\'t contain StructTreeRoot."
public static final String
"Document for copyTo cannot be null."
public static final String
"Document has no PDF Catalog object."
public static final String
"The PDF document has not been read yet. Document reading occurs in PdfDocument class constructor"
public static final String
"During decompression multiple streams in sum occupied more memory than allowed. Please either check your pdf or increase the allowed single decompressed pdf stream maximum size value by setting the appropriate parameter of ReaderProperties\'s MemoryLimitsAwareHandler."
public static final String
"During decompression a single stream occupied more memory than allowed. Please either check your pdf or increase the allowed multiple decompressed pdf streams maximum size value by setting the appropriate parameter of ReaderProperties\'s MemoryLimitsAwareHandler."
public static final String
"During decompression a single stream occupied more than a maximum integer value. Please check your pdf."
public static final String
"Encrypted payload file spec shall have encrypted payload dictionary."
public static final String
"Encrypted payload file spec shall be indirect."
public static final String
"Encrypted payload file spec shall have \'EF\' key. The value of such key shall be a dictionary that contains embedded file stream."
public static final String
"Encrypted payload file spec shall have \'Type\' key. The value of such key shall be \'Filespec\'."
public static final String
"Encrypted payload shall have \'Subtype\' field specifying crypto filter"
public static final String
"Encrypted payload dictionary shall have field \'Type\' equal to \'EncryptedPayload\' if present"
public static final String
"End of content stream reached before end of image data."
public static final String
"Exception initializing AES cipher."
public static final String
"Error while reading Object Stream."
public static final String
"External entity element found in XML. This entity will not be parsed to prevent XML attacks."
public static final String
"file position 0 cross reference entry in this xref subsection."
public static final String
"Filter CCITTFaxDecode is only supported for images"
public static final String
"filter is not a name or array."
public static final String
"Flushed page cannot be added or inserted."
public static final String
"Flushed page cannot be removed from a document which is tagged or has an AcroForm"
public static final String
"Stream {0} {1} R contains flushed indirect filter object in encrypted document, try to use PdfStream#flush() stream before PdfDocument#close() to prevent this exception"
public static final String
"Flushing writes the object to the output stream and releases it from memory. It is only possible for documents that have a PdfWriter associated with them. Use PageFlushingHelper#releaseDeep method instead."
public static final String
"Font and size must be set before writing any text."
public static final String
"Font embedding issue."
public static final String
"Form XObject must have BBox."
public static final String
"Invalid function type {0}"
public static final String
"Invalid object type, a function must be either a Dictionary or a Stream"
public static final String
"Invalid object type, a function type 0 requires a stream object"
public static final String
"Invalid object type, a function type 4 requires a stream object"
public static final String
"Function is not compatible with ColorSpace."
public static final String
"The output size depends on the functions, but no function is set yet."
public static final String
"Only RGB alternate color spaces are currently supported for extracting separation color images"
public static final String
"Illegal character in ASCII85Decode."
public static final String
"illegal character in ASCIIHexDecode."
public static final String
"Illegal length value."
public static final String
"Illegal R value."
public static final String
"Illegal V value."
public static final String
"In a page label the page numbers must be greater or equal to 1."
public static final String
"Incorrect number of components."
public static final String
"The size of the input array must be a multiple of the domain size"
public static final String
"The size of the input array must be a multiple of the range size"
public static final String
"Invalid cross reference entry in this xref subsection."
public static final String
"Invalid indirect reference {0}."
public static final String
"Invalid input value for PDF Type 2 Function, value should be a single number."
public static final String
"Invalid input value for PDF Type 3 Function, value should be a single number."
public static final String
"The offset + length must be lower than or equal to the length of the byte array."
public static final String
"The length must be a multiple of {0}."
public static final String
"Tne media box object has incorrect values."
public static final String
"Object reference has unsupported type, supported types are dictionaries and streams"
public static final String
"Unable to read object {0} with object stream number {1} and index {2} from object stream."
public static final String
"Invalid offset for object {0}."
public static final String
"Invalid page structure {0}."
public static final String
"Invalid page structure. /Pages must be PdfDictionary."
public static final String
"Invalid range array."
public static final String
"Invalid PDF Type 2 Function object, \"Domain\" array shall consist of 2 numbers."
public static final String
"Invalid PDF Type 2 Function object, \"N\" field should exist and must be a number."
public static final String
"Invalid PDF Type 2 Function object, when \"N\" is negative, values of \"Domain\" shall not allow zero as input value."
public static final String
"Invalid PDF Type 2 Function object, when \"N\" is not an integer, values of \"Domain\" shall define the input value as non-negative."
public static final String
"Invalid PDF Type 2 Function object, if present the size of \"C0\", \"C1\" and half \"Range\" shall be equal."
public static final String
"Invalid PDF Type 3 Function object, \"Bounds\" elements shall be in order of increasing value, and each value shall be within the domain defined by \"Domain\"."
public static final String
"Invalid PDF Type 3 Function object, \"Domain\" array shall consist of 2 numbers."
public static final String
"Invalid PDF Type 3 Function object, all functions shall have 1 input value."
public static final String
"Invalid PDF Type 3 Function object, the output dimensionality of all functions shall be the same, and compatible with the value of \"Range\"."
public static final String
"Invalid PDF Type 3 Function object, \"Bounds\" array should exist and its size should correspond to the size of the \"Functions\" array."
public static final String
"Invalid PDF Type 3 Function object, \"Encode\" array should exist and its size should be 2 times more than the size of the \"Functions\" array."
public static final String
"Invalid PDF Type 3 Function object, \"Functions\" array should exist and can\'t be empty."
public static final String
"Invalid xref stream."
public static final String
"Invalid xref table."
public static final String
"I/O exception."
public static final String
"I/O exception while creating Font"
public static final String
"LZW decoder exception."
public static final String
"LZW flavour not supported."
public static final String
"Missing required field {0} in font dictionary."
public static final String
"Must be a tagged document."
public static final String
"No compatible encryption found."
public static final String
"No glyphs defined for type3 font."
public static final String
"No kid with such role."
public static final String
"no such algorithm: {0} for provider BCFIPS"
public static final String
"No valid encryption mode."
public static final String
"A noninvertible matrix has been parsed. The behaviour is unpredictable."
public static final String
"Not a placeable windows metafile."
public static final String
"{0} is not a valid placeable windows metafile."
public static final String
"Not a WMF image."
public static final String
"The number of booleans in the array doesn\'t correspond with the number of fields."
public static final String
"Number of entries in this xref subsection not found."
public static final String
"Number of pages can not be negative."
public static final String
"Object must be indirect to work with this wrapper."
public static final String
"Object number of the first object in this xref subsection not found."
public static final String
"Only BMP can be wrapped in WMF."
public static final String
"Only Identity CMaps supports with truetype"
public static final String
"Operator EI not found after the end of image data."
public static final String
"Ordering should be determined for CIDFont of Type0 font."
public static final String
"The page has been already flushed."
public static final String
"The passed page belongs to document {0} (page {1} of the document) and therefore cannot be added to this document ({2})."
public static final String
"Page is not set for the pdf tag structure."
public static final String
"Exception occurred with PDF document decryption. One of the possible reasons is wrong password or wrong public key certificate and private key."
public static final String
"PdfEncryption exception."
public static final String
"PdfFormXObject has invalid BBox."
public static final String
"Pdf indirect object belongs to other PDF document. Copy object to current pdf document."
public static final String
"PdfObjectStream reach max size."
public static final String
"PdfPages tree could be generated only once."
public static final String
"Given PdfReader instance has already been utilized. The PdfReader cannot be reused, please create a new instance."
public static final String
"PDF startxref is not followed by a number."
public static final String
"PDF startxref not found."
public static final String
"bitsPerSample value must be from {1, 2, 4, 8, 12, 16, 24, 32}"
public static final String
"Invalid decode array for PDF function of type 0"
public static final String
"Invalid domain for PDF function of type 0"
public static final String
"Invalid encode array for PDF function of type 0"
public static final String
"Order must be equal to 1 or 3"
public static final String
"Invalid encode array for PDF function of type 0"
public static final String
"Invalid samples array for PDF function of type 0"
public static final String
"Invalid size array for PDF function of type 0"
public static final String
"Domain, range and size must be not null"
public static final String
"PDF version is not valid."
public static final String
"PNG filter unknown."
public static final String
"/PrintScaling shall may appear in the Enforce array only if the corresponding entry in the viewer preferences dictionary specifies a valid value other than AppDefault"
public static final String
"The QuadPoint Array length is not a multiple of 8."
public static final String
"Ref array items in structure element dictionary shall be indirect objects."
public static final String
"Requested page number {0} is out of bounds."
public static final String
"Resources cannot be null."
public static final String
"Resources do not contain ExtGState entry. Unable to process operator {0}."
public static final String
"Role \"{0}\" in namespace {1} is not mapped to any standard role."
public static final String
"Role \"{0}\" is not mapped to any standard role."
public static final String
"Shading type not found."
public static final String
"/StdCF not found (encryption)"
public static final String
"Stream shall end with endstream keyword."
public static final String
"StructParent index not found in tagged object."
public static final String
"Structure element dictionary shall be an indirect object in order to have children."
public static final String
"Structure element referenced by a structure destination shall be an indirect object."
public static final String
"StructureElement shall contain parent object."
public static final String
"Tag cannot be moved to the another document\'s tag structure."
public static final String
"Tag from the existing tag structure is flushed. Cannot add copied page tags."
public static final String
"Tag structure copying failed: it might be corrupted in one of the documents."
public static final String
"Tag structure flushing failed: it might be corrupted."
public static final String
"TagTreePointer is in invalid state: it points at flushed element. Use TagTreePointer#moveToRoot."
public static final String
"TagTreePointer is in invalid state: it points at removed element use TagTreePointer#moveToRoot."
public static final String
"There is no associate PdfWriter for making indirects."
public static final String
"Decode parameter type {0} is not supported."
public static final String
"Dictionary key {0} is not a name."
public static final String
"Filter {0} is not supported."
public static final String
"To manually flush this wrapper, you have to ensure that the object behind this wrapper is added to the document, i.e. it has an indirect reference."
public static final String
"Pdf contains too many xObject elements on a page and may cause OOM exception. You can increase page size limit by setting custom MemoryLimitsAwareHandler."
public static final String
"Trailer not found."
public static final String
"Trailer prev entry points to its own cross reference section."
public static final String
"Type 4 functions are not yet supported for separation color image extraction."
public static final String
"Unable to read object stream."
public static final String
"Unable to read stream bytes because stream is null."
public static final String
"{0} is not an acceptable value for the field {1}."
public static final String
"Unbalanced begin/end marked content operators."
public static final String
"Unbalanced layer operators."
public static final String
"Unbalanced save restore state operators."
public static final String
"Unexpected character {0} found after ID in inline image."
public static final String
"Unexpected ColorSpace: {0}."
public static final String
"Unexpected end of file."
public static final String
"Unexpected shading type."
public static final String
"unexpected {0} was encountered."
public static final String
"Unknown encryption type R == {0}."
public static final String
"Unknown encryption type V == {0}."
public static final String
"{0} is an unknown graphics state dictionary."
public static final String
"Unknown PdfException."
public static final String
"Unknown ASN1-encoding {0}. Only DER and BER encodings are supported!"
public static final String
"Unsupported font embedding strategy."
public static final String
"Failed to open the document. Security handler {0} is not supported"
public static final String
"Unsupported XObject type."
public static final String
"When adding object reference to the tag tree, it must be connected to not flushed object."
public static final String
"White point is incorrectly specified."
public static final String
"WMF image exception."
public static final String
"Wrong media box size: {0}. Need at least 4 arguments"
public static final String
"XObject has no StructParents index in its stream."
public static final String
"Pdf document is to large to use normal cross reference table. Use cross reference streams instead. To enable feature use com.itextpdf.kernel.pdf.WriterProperties#setFullCompressionMode(true). "
public static final String
"Prev pointer in xref structure shall be direct number object."
public static final String
"Xref stream has cycled references. Prev pointer indicates an already visited xref stream."
public static final String
"Xref structure contains too many elements and may cause OOM exception. You can increase number of elements by setting custom MemoryLimitsAwareHandler."
public static final String
"xref subsection not found."
public static final String
"Xref table has cycled references. Prev pointer indicates an already visited xref table."
public static final String
"You have to define a boolean array for this collection sort dictionary."
public static final String
"You must set a value before adding a prefix."
public static final String
"You need a single boolean for this collection sort dictionary."
-
com.itextpdf.kernel.font.FontUtil
-
com.itextpdf.kernel.font.PdfFont
-
com.itextpdf.kernel.font.PdfFontFactoryModifier and TypeConstant FieldValue
private static final boolean
true
private static final String
""
-
com.itextpdf.kernel.font.PdfType0FontModifier and TypeConstant FieldValue
protected static final int
0
protected static final int
2
private static final String
""
private static final int
4
-
com.itextpdf.kernel.font.PdfType3FontModifier and TypeConstant FieldValue
private static final int
0
private static final int
1
private static final int
2
private static final int
3
-
com.itextpdf.kernel.font.Type3Glyph
-
com.itextpdf.kernel.geom.AffineTransformModifier and TypeConstant FieldValue
public static final int
64
public static final int
16
public static final int
4
public static final int
32
public static final int
0
public static final int
24
public static final int
6
public static final int
8
public static final int
1
public static final int
2
static final int
-1
static final double
1.0E-10
-
com.itextpdf.kernel.geom.MatrixModifier and TypeConstant FieldValue
public static final int
0
public static final int
1
public static final int
2
public static final int
3
public static final int
4
public static final int
5
public static final int
6
public static final int
7
public static final int
8
-
com.itextpdf.kernel.geom.NoninvertibleTransformExceptionModifier and TypeConstant FieldValue
public static final String
"Determinant is zero. Cannot invert transformation."
-
com.itextpdf.kernel.geom.PathModifier and TypeConstant FieldValue
private static final String
"Path shall start with \"re\" or \"m\" operator"
-
com.itextpdf.kernel.geom.Vector
-
com.itextpdf.kernel.logs.KernelLogMessageConstantModifier and TypeConstant FieldValue
public static final String
"Cannot merge entry {0}, entry with such key already exists."
public static final String
"Document outline dictionary is corrupted: some outline (PDF object: \"{0}\") has wrong first/next link entry. Next outlines in this dictionary will be unprocessed."
public static final String
"DCTDecode filter decoding into the bit map is not supported. The stream data would be left in JPEG baseline format"
public static final String
"Exception finalizing AES cipher."
public static final String
"Exception was thrown: {0}. The feature {1} is probably not supported by your XML processor."
public static final String
"Flattening annotation type {0} is not yet supported, it will not be removed from the page"
public static final String
"Form field annotation flattening is not supported. Use the PdfAcroForm#flattenFields() method instead."
public static final String
"Full compression mode was requested to be switched off in append mode but the original document has cross-reference stream, not cross-reference table. Falling back to cross-reference stream in appended document and switching full compression on"
public static final String
"Full compression mode requested in append mode but the original document has cross-reference table, not cross-reference stream. Falling back to cross-reference table in appended document and switching full compression off"
public static final String
"The default configuration dictionary field {0} has a value of {1}, which is not the required value for this field. The field will not be processed."
public static final String
"JPXDecode filter decoding into the bit map is not supported. The stream data would be left in JPEG2000 format"
public static final String
"MD5 hash algorithm is not FIPS compliant. However we still use this algorithm since it is required according to the PDF specification."
public static final String
"StructParent index not found in tagged object, so index is recreated."
public static final String
"Unable to parse color {0} within {1} color space"
public static final String
"Event for the product {0} with type {1} was reported but was not confirmed. Probably appropriate process fail"
public static final String
"Unknown product {0} was involved into PDF processing. It will be ignored"
public static final String
"XObject has no StructParents index in its stream, so index is recreated"
-
com.itextpdf.kernel.numbering.EnglishAlphabetNumbering
-
com.itextpdf.kernel.numbering.GreekAlphabetNumbering
-
com.itextpdf.kernel.pdf.CompressionConstantsModifier and TypeConstant FieldValue
public static final int
9
public static final int
1
public static final int
-1
public static final int
0
public static final int
-2147483648
-
com.itextpdf.kernel.pdf.EncryptionConstantsModifier and TypeConstant FieldValue
public static final int
1024
public static final int
16
public static final int
4
public static final int
256
public static final int
32
public static final int
8
public static final int
2052
public static final int
512
public static final int
8
public static final int
24
public static final int
2
public static final int
3
static final int
7
public static final int
1
public static final int
0
-
com.itextpdf.kernel.pdf.GenericNameTree
-
com.itextpdf.kernel.pdf.MemoryLimitsAwareHandlerModifier and TypeConstant FieldValue
private static final int
50000000
private static final long
3221225472L
private static final int
500000
private static final int
21474836
private static final int
100
private static final long
107374182L
private static final int
500
-
com.itextpdf.kernel.pdf.com.itextpdf.kernel.pdf.MemoryLimitsAwareOutputStream
-
com.itextpdf.kernel.pdf.PdfAConformanceLevel
-
com.itextpdf.kernel.pdf.PdfCatalog
-
com.itextpdf.kernel.pdf.PdfEncryptionModifier and TypeConstant FieldValue
private static final int
4
private static final int
5
private static final int
40
private static final int
3
private static final int
2
-
com.itextpdf.kernel.pdf.PdfIndirectReference
-
com.itextpdf.kernel.pdf.PdfNumTree
-
com.itextpdf.kernel.pdf.PdfObjectModifier and TypeConstant FieldValue
public static final byte
0x1
public static final byte
0x2
public static final byte
0x3
protected static final short
1
protected static final short
128
protected static final short
2
public static final byte
0x5
public static final byte
0x4
protected static final short
8
protected static final short
32
protected static final short
64
public static final byte
0x6
public static final byte
0x7
public static final byte
0x8
protected static final short
16
protected static final short
256
protected static final short
4
public static final byte
0x9
public static final byte
0xa
protected static final short
512
-
com.itextpdf.kernel.pdf.com.itextpdf.kernel.pdf.PdfObjectStream
-
com.itextpdf.kernel.pdf.com.itextpdf.kernel.pdf.PdfPagesTreeModifier and TypeConstant FieldValue
static final int
10
private final int
10
-
com.itextpdf.kernel.pdf.PdfReader
-
com.itextpdf.kernel.pdf.PdfResourcesModifier and TypeConstant FieldValue
private static final String
"Cs"
private static final String
"F"
private static final String
"Fm"
private static final String
"Gs"
private static final String
"Im"
private static final String
"P"
private static final String
"Pr"
private static final String
"Sh"
-
com.itextpdf.kernel.pdf.PdfXrefTableModifier and TypeConstant FieldValue
private static final int
32
private static final int
65535
private static final long
9999999999L
-
com.itextpdf.kernel.pdf.VersionConformingModifier and TypeConstant FieldValue
public static final String
"It seems that PDF 1.7 document encrypted with AES256 was updated to PDF 2.0 version and StampingProperties#preserveEncryption flag was set: encryption shall be updated via WriterProperties#setStandardEncryption method. Standard security handler was found with revision 5, which is deprecated and shall not be used in PDF 2.0 documents."
public static final String
"Encryption algorithms STANDARD_ENCRYPTION_40, STANDARD_ENCRYPTION_128 and ENCRYPTION_AES_128 (see com.itextpdf.kernel.pdf.EncryptionConstants) are deprecated in PDF 2.0. It is highly recommended not to use it."
public static final String
"NeedAppearances has been deprecated in PDF 2.0. Appearance streams are required in PDF 2.0."
public static final String
"XFA is deprecated in PDF 2.0. The XFA form will not be written to the document"
-
com.itextpdf.kernel.pdf.action.PdfActionModifier and TypeConstant FieldValue
public static final int
1
public static final int
512
public static final int
16
public static final int
8196
public static final int
2048
public static final int
1024
public static final int
1
public static final int
4
public static final int
8
public static final int
128
public static final int
64
public static final int
2
public static final int
256
public static final int
32
-
com.itextpdf.kernel.pdf.annot.PdfAnnotationModifier and TypeConstant FieldValue
public static final int
2
public static final int
1
public static final int
128
public static final int
512
public static final int
16
public static final int
32
public static final int
8
public static final int
4
public static final int
64
public static final int
256
-
com.itextpdf.kernel.pdf.annot.PdfFreeTextAnnotationModifier and TypeConstant FieldValue
public static final int
1
public static final int
0
public static final int
2
-
com.itextpdf.kernel.pdf.annot.PdfWidgetAnnotationModifier and TypeConstant FieldValue
public static final int
1
public static final int
3
public static final int
4
public static final int
2
-
com.itextpdf.kernel.pdf.canvas.PdfCanvasModifier and TypeConstant FieldValue
private static final float
9.999999747378752E-5f
-
com.itextpdf.kernel.pdf.canvas.PdfCanvasConstants.FillingRuleModifier and TypeConstant FieldValue
public static final int
2
public static final int
1
-
com.itextpdf.kernel.pdf.canvas.PdfCanvasConstants.LineCapStyleModifier and TypeConstant FieldValue
public static final int
0
public static final int
2
public static final int
1
-
com.itextpdf.kernel.pdf.canvas.PdfCanvasConstants.LineJoinStyle
-
com.itextpdf.kernel.pdf.canvas.PdfCanvasConstants.TextRenderingModeModifier and TypeConstant FieldValue
public static final int
7
public static final int
0
public static final int
4
public static final int
2
public static final int
6
public static final int
3
public static final int
1
public static final int
5
-
com.itextpdf.kernel.pdf.canvas.parser.PdfCanvasProcessor
-
com.itextpdf.kernel.pdf.canvas.parser.clipper.ClipperBase
-
com.itextpdf.kernel.pdf.canvas.parser.clipper.ClipperExceptionConstantModifier and TypeConstant FieldValue
public static final String
"Coordinate outside allowed range."
-
com.itextpdf.kernel.pdf.canvas.parser.clipper.ClipperOffsetModifier and TypeConstant FieldValue
private static final double
0.25
private static final double
1.0E-20
private static final double
6.283185307179586
-
com.itextpdf.kernel.pdf.canvas.parser.clipper.com.itextpdf.kernel.pdf.canvas.parser.clipper.EdgeModifier and TypeConstant FieldValue
protected static final double
-3.4E38
protected static final int
-2
protected static final int
-1
-
com.itextpdf.kernel.pdf.canvas.parser.clipper.IClipperModifier and TypeConstant FieldValue
public static final int
4
public static final int
1
public static final int
2
-
com.itextpdf.kernel.pdf.canvas.parser.data.PathRenderInfo
-
com.itextpdf.kernel.pdf.canvas.parser.listener.RegexBasedLocationExtractionStrategy
-
com.itextpdf.kernel.pdf.canvas.parser.listener.com.itextpdf.kernel.pdf.canvas.parser.listener.TextChunkLocationDefaultImpModifier and TypeConstant FieldValue
private static final float
2.0f
-
com.itextpdf.kernel.pdf.canvas.wmf.MetaBrushModifier and TypeConstant FieldValue
public static final int
5
public static final int
2
public static final int
1
public static final int
3
public static final int
0
public static final int
3
public static final int
4
public static final int
5
public static final int
2
public static final int
0
public static final int
1
-
com.itextpdf.kernel.pdf.canvas.wmf.MetaDoModifier and TypeConstant FieldValue
public static final int
1078
public static final int
2071
public static final int
2338
public static final int
2096
public static final int
764
public static final int
763
public static final int
247
public static final int
505
public static final int
762
public static final int
1791
public static final int
496
public static final int
2368
public static final int
322
public static final int
2881
public static final int
1048
public static final int
1574
public static final int
1045
public static final int
1352
public static final int
2610
public static final int
552
public static final int
1049
public static final int
1065
public static final int
1046
public static final int
298
public static final int
531
public static final int
532
public static final int
544
public static final int
529
public static final int
527
public static final int
299
public static final int
1565
public static final int
2074
public static final int
804
public static final int
805
public static final int
1336
public static final int
53
public static final int
1051
public static final int
313
public static final int
295
public static final int
1564
public static final int
30
public static final int
1042
public static final int
1040
public static final int
300
public static final int
301
public static final int
564
public static final int
513
public static final int
258
public static final int
3379
public static final int
259
public static final int
561
public static final int
55
public static final int
1055
public static final int
262
public static final int
261
public static final int
260
public static final int
263
public static final int
302
public static final int
264
public static final int
521
public static final int
522
public static final int
526
public static final int
525
public static final int
524
public static final int
523
public static final int
2851
public static final int
3907
public static final int
1313
-
com.itextpdf.kernel.pdf.canvas.wmf.MetaFontModifier and TypeConstant FieldValue
static final int
600
static final int
0
static final int
4
static final int
2
static final int
5
static final int
0
static final int
3
static final int
1
static final int
4
static final int
2
static final int
1
static final int
1
static final int
0
static final int
4
static final int
2
static final int
12
static final int
8
static final int
32
static final int
2
-
com.itextpdf.kernel.pdf.canvas.wmf.MetaObjectModifier and TypeConstant FieldValue
public static final int
2
public static final int
3
public static final int
0
public static final int
1
-
com.itextpdf.kernel.pdf.canvas.wmf.MetaPenModifier and TypeConstant FieldValue
public static final int
1
public static final int
3
public static final int
4
public static final int
2
public static final int
6
public static final int
5
public static final int
0
-
com.itextpdf.kernel.pdf.canvas.wmf.MetaStateModifier and TypeConstant FieldValue
public static final int
1
public static final int
2
public static final int
24
public static final int
8
public static final int
6
public static final int
0
public static final int
0
public static final int
2
public static final int
0
public static final int
1
public static final int
1
public static final int
2
-
com.itextpdf.kernel.pdf.collection.PdfCollection
-
com.itextpdf.kernel.pdf.collection.PdfCollectionFieldModifier and TypeConstant FieldValue
public static final int
6
public static final int
1
public static final int
4
public static final int
3
public static final int
5
public static final int
2
public static final int
7
public static final int
0
-
com.itextpdf.kernel.pdf.colorspace.PdfPattern.Tiling.PaintType
-
com.itextpdf.kernel.pdf.colorspace.PdfPattern.Tiling.TilingTypeModifier and TypeConstant FieldValue
public static final int
1
public static final int
3
public static final int
2
-
com.itextpdf.kernel.pdf.colorspace.com.itextpdf.kernel.pdf.colorspace.PdfShading.ShadingTypeModifier and TypeConstant FieldValue
public static final int
2
public static final int
6
public static final int
4
public static final int
1
public static final int
5
public static final int
3
public static final int
7
-
com.itextpdf.kernel.pdf.function.PdfFunctionFactoryModifier and TypeConstant FieldValue
public static final int
0
public static final int
2
public static final int
3
public static final int
4
-
com.itextpdf.kernel.pdf.layer.PdfOCProperties
-
com.itextpdf.kernel.pdf.statistics.NumberOfPagesStatisticsAggregatorModifier and TypeConstant FieldValue
private static final int
100
private static final int
1
private static final String
"11-100"
private static final String
"1001+"
private static final String
"1"
private static final String
"2-10"
private static final String
"101-1000"
private static final int
10
private static final int
1000
-
com.itextpdf.kernel.pdf.statistics.NumberOfPagesStatisticsEvent
-
com.itextpdf.kernel.pdf.statistics.SizeOfPdfStatisticsAggregatorModifier and TypeConstant FieldValue
private static final long
1024L
private static final long
131072L
private static final long
134217728L
private static final long
16777216L
private static final long
1048576L
private static final String
"<128kb"
private static final String
"16mb-128mb"
private static final String
"1mb-16mb"
private static final String
"128kb-1mb"
private static final String
"128mb+"
-
com.itextpdf.kernel.pdf.statistics.SizeOfPdfStatisticsEvent
-
com.itextpdf.kernel.pdf.tagging.StandardNamespaces
-
com.itextpdf.kernel.pdf.tagging.StandardRolesModifier and TypeConstant FieldValue
public static final String
"Annot"
public static final String
"Art"
public static final String
"Artifact"
public static final String
"Aside"
public static final String
"BibEntry"
public static final String
"BlockQuote"
public static final String
"Caption"
public static final String
"Code"
public static final String
"Div"
public static final String
"Document"
public static final String
"DocumentFragment"
public static final String
"Em"
public static final String
"FENote"
public static final String
"Figure"
public static final String
"Form"
public static final String
"Formula"
public static final String
"H"
public static final String
"H1"
public static final String
"H2"
public static final String
"H3"
public static final String
"H4"
public static final String
"H5"
public static final String
"H6"
public static final String
"Index"
public static final String
"L"
public static final String
"Lbl"
public static final String
"LBody"
public static final String
"LI"
public static final String
"Link"
public static final String
"NonStruct"
public static final String
"Note"
public static final String
"P"
public static final String
"Part"
public static final String
"Private"
public static final String
"Quote"
public static final String
"RB"
public static final String
"Reference"
public static final String
"RP"
public static final String
"RT"
public static final String
"Ruby"
public static final String
"Sect"
public static final String
"Span"
public static final String
"Strong"
public static final String
"Sub"
public static final String
"Table"
public static final String
"TBody"
public static final String
"TD"
public static final String
"TFoot"
public static final String
"TH"
public static final String
"THead"
public static final String
"Title"
public static final String
"TOC"
public static final String
"TOCI"
public static final String
"TR"
public static final String
"Warichu"
public static final String
"WP"
public static final String
"WT"
-
com.itextpdf.kernel.pdf.tagutils.TagTreePointer
-
com.itextpdf.kernel.utils.CompareToolModifier and TypeConstant FieldValue
private static final String
"\u00a9\\d+-\\d+ (?:iText Group NV|Apryse Group NV)"
private static final String
"\u00a9<copyright years> Apryse Group NV"
private static final String
"File file://<filename> differs on page <pagenumber>."
private static final String
"file://"
private static final String
"ignored_areas_"
private static final String
"\\r|\\n"
private static final String
"Unexpected number of pages for <filename>."
private static final String
"(\\d+\\.)+\\d+(-SNAPSHOT)?"
private static final String
"<version>"
-
com.itextpdf.kernel.utils.DefaultSafeXmlParserFactoryModifier and TypeConstant FieldValue
private static final String
"http://apache.org/xml/features/disallow-doctype-decl"
private static final String
"http://xml.org/sax/features/external-general-entities"
private static final String
"http://xml.org/sax/features/external-parameter-entities"
private static final String
"http://apache.org/xml/features/nonvalidating/load-external-dtd"
-
com.itextpdf.kernel.utils.com.itextpdf.kernel.utils.MemoryFirstPdfWriter
-
com.itextpdf.kernel.utils.annotationsflattening.AbstractTextMarkupAnnotationFlattener
-
com.itextpdf.kernel.utils.annotationsflattening.SquigglyTextMarkupAnnotationFlattener
-
com.itextpdf.kernel.utils.objectpathitems.TrailerPathModifier and TypeConstant FieldValue
private static final String
"Base cmp object: trailer. Base out object: trailer"
-
com.itextpdf.kernel.xmp.PdfConstModifier and TypeConstant FieldValue
public static final String
"Advisory"
public static final String
"BaseURL"
public static final String
"contributor"
public static final String
"coverage"
public static final String
"CreateDate"
public static final String
"creator"
public static final String
"CreatorTool"
public static final String
"date"
public static final String
"description"
public static final String
"format"
public static final String
"identifier"
public static final String
"Keywords"
public static final String
"language"
public static final String
"MetadataDate"
public static final String
"ModifyDate"
public static final String
"Nickname"
public static final String
"part"
public static final String
"Producer"
public static final String
"publisher"
public static final String
"relation"
public static final String
"rights"
public static final String
"source"
public static final String
"subject"
public static final String
"Thumbnails"
public static final String
"title"
public static final String
"Trapped"
public static final String
"type"
public static final String
"PDFVersion"
-
com.itextpdf.kernel.xmp.XMPConstModifier and TypeConstant FieldValue
public static final String
"[]"
public static final int
-1
public static final String
"conformance"
public static final String
"False"
public static final String
"History"
public static final String
"http://ns.adobe.com/StockPhoto/1.0/"
public static final String
"http://ns.adobe.com/asf/1.0/"
public static final String
"http://ns.adobe.com/bwf/bext/1.0/"
public static final String
"http://ns.adobe.com/camera-raw-settings/1.0/"
public static final String
"http://ns.adobe.com/creatorAtom/1.0/"
public static final String
"http://purl.org/dc/elements/1.1/"
public static final String
"http://purl.org/dc/1.1/"
public static final String
"http://ns.adobe.com/DICOM/"
public static final String
"http://ns.adobe.com/xmp/1.0/DynamicMedia/"
public static final String
"http://ns.adobe.com/exif/1.0/"
public static final String
"http://ns.adobe.com/exif/1.0/aux/"
public static final String
"http://cipa.jp/exif/1.0/"
public static final String
"http://iptc.org/std/Iptc4xmpCore/1.0/xmlns/"
public static final String
"http://iptc.org/std/Iptc4xmpExt/2008-02-29/"
public static final String
"http://ns.adobe.com/iX/1.0/"
public static final String
"http://ns.adobe.com/jp2k/1.0/"
public static final String
"http://ns.adobe.com/jpeg/1.0/"
public static final String
"http://ns.adobe.com/pdf/1.3/"
public static final String
"http://www.aiim.org/pdfa/ns/extension/"
public static final String
"http://www.aiim.org/pdfa/ns/field#"
public static final String
"http://www.aiim.org/pdfa/ns/id/"
public static final String
"http://www.aiim.org/pdfa/ns/property#"
public static final String
"http://www.aiim.org/pdfa/ns/schema#"
public static final String
"http://www.aiim.org/pdfa/ns/type#"
public static final String
"http://www.aiim.org/pdfua/ns/id/"
public static final String
"http://ns.adobe.com/pdfx/1.3/"
public static final String
"http://www.npes.org/pdfx/ns/id/"
public static final String
"http://ns.adobe.com/photoshop/1.0/"
public static final String
"http://ns.useplus.org/ldf/xmp/1.0/"
public static final String
"http://ns.adobe.com/png/1.0/"
public static final String
"http://ns.adobe.com/album/1.0/"
public static final String
"http://www.w3.org/1999/02/22-rdf-syntax-ns#"
public static final String
"http://ns.adobe.com/riff/info/"
public static final String
"http://ns.adobe.com/xmp/1.0/Script/"
public static final String
"http://ns.adobe.com/swf/1.0/"
public static final String
"http://ns.adobe.com/tiff/1.0/"
public static final String
"http://ns.adobe.com/xmp/transient/1.0/"
public static final String
"http://ns.adobe.com/TransformXMP/"
public static final String
"http://ns.adobe.com/xmp/wav/1.0/"
public static final String
"adobe:ns:meta/"
public static final String
"http://www.w3.org/XML/1998/namespace"
public static final String
"http://ns.adobe.com/xap/1.0/"
public static final String
"http://ns.adobe.com/xap/1.0/bj/"
public static final String
"http://ns.adobe.com/xap/1.0/mm/"
public static final String
"http://ns.adobe.com/xmp/note/"
public static final String
"http://ns.adobe.com/xap/1.0/rights/"
public static final String
"part"
public static final String
"rdf:type"
public static final String
"rev"
public static final String
"xapmeta"
public static final String
"xmpmeta"
public static final String
"title"
public static final String
"True"
public static final String
"http://ns.adobe.com/xap/1.0/sType/Dimensions#"
public static final String
"http://ns.adobe.com/xap/1.0/sType/Font#"
public static final String
"http://ns.adobe.com/xap/1.0/g/"
public static final String
"http://ns.adobe.com/xmp/Identifier/qual/1.0/"
public static final String
"http://ns.adobe.com/xap/1.0/g/img/"
public static final String
"http://ns.adobe.com/xap/1.0/sType/ManifestItem#"
public static final String
"http://ns.adobe.com/xap/1.0/t/pg/"
public static final String
"http://ns.adobe.com/xap/1.0/sType/ResourceEvent#"
public static final String
"http://ns.adobe.com/xap/1.0/sType/ResourceRef#"
public static final String
"http://ns.adobe.com/xap/1.0/sType/Job#"
public static final String
"http://ns.adobe.com/xap/1.0/sType/Version#"
public static final String
"http://ns.adobe.com/xap/1.0/t/"
public static final String
"x-default"
public static final String
"xml:lang"
public static final String
"xpacket"
-
com.itextpdf.kernel.xmp.XMPErrorModifier and TypeConstant FieldValue
public static final int
104
public static final int
103
public static final int
4
public static final int
202
public static final int
101
public static final int
107
public static final int
204
public static final int
5
public static final int
201
public static final int
203
public static final int
102
public static final int
9
public static final int
0
-
com.itextpdf.kernel.xmp.impl.Base64Modifier and TypeConstant FieldValue
private static final byte
0xfd
private static final byte
0xff
private static final byte
0xfe
-
com.itextpdf.kernel.xmp.impl.FixASCIIControlsReaderModifier and TypeConstant FieldValue
private static final int
8
private static final int
1
private static final int
4
private static final int
5
private static final int
2
private static final int
3
private static final int
0
-
com.itextpdf.kernel.xmp.impl.Latin1ConverterModifier and TypeConstant FieldValue
private static final int
0
private static final int
11
-
com.itextpdf.kernel.xmp.impl.ParseRDFModifier and TypeConstant FieldValue
public static final String
"_dflt"
public static final int
3
public static final int
10
public static final int
11
public static final int
12
public static final int
7
public static final int
8
public static final int
1
public static final int
10
public static final int
1
public static final int
2
public static final int
7
public static final int
12
public static final int
9
public static final int
9
public static final int
6
public static final int
0
public static final int
4
public static final int
1
public static final int
5
-
com.itextpdf.kernel.xmp.impl.UtilsModifier and TypeConstant FieldValue
public static final int
36
public static final int
4
-
com.itextpdf.kernel.xmp.impl.com.itextpdf.kernel.xmp.impl.XMPIteratorImpl.NodeIteratorModifier and TypeConstant FieldValue
protected static final int
1
protected static final int
0
protected static final int
2
-
com.itextpdf.kernel.xmp.impl.XMPMetaImplModifier and TypeConstant FieldValue
private static final int
7
private static final int
1
private static final int
6
private static final int
5
private static final int
4
private static final int
2
private static final int
3
private static final int
0
-
com.itextpdf.kernel.xmp.impl.XMPNodeUtilsModifier and TypeConstant FieldValue
static final int
5
static final int
3
static final int
0
static final int
2
static final int
1
static final int
4
-
com.itextpdf.kernel.xmp.impl.XMPSerializerRDFModifier and TypeConstant FieldValue
private static final int
2048
private static final String
"<?xpacket begin=\"\ufeff\" id=\"W5M0MpCehiHzreSzNTczkc9d\"?>"
private static final String
"<?xpacket end=\""
private static final String
"\"?>"
private static final String
"<rdf:Description/>"
private static final String
"</rdf:RDF>"
private static final String
"<rdf:RDF xmlns:rdf=\"http://www.w3.org/1999/02/22-rdf-syntax-ns#\">"
private static final String
"</rdf:Description>"
private static final String
"<rdf:Description rdf:about="
private static final String
"</rdf:Description>"
private static final String
"<rdf:Description"
private static final String
"</x:xmpmeta>"
private static final String
"<x:xmpmeta xmlns:x=\"adobe:ns:meta/\" x:xmptk=\""
-
com.itextpdf.kernel.xmp.impl.XMPUtilsImplModifier and TypeConstant FieldValue
private static final String
",\uff0c\uff64\ufe50\ufe51\u3001\u060c\u055d"
private static final String
"\u2028\u2029"
private static final String
"\"\u00ab\u00bb\u301d\u301e\u301f\u2015\u2039\u203a"
private static final String
";\uff1b\ufe54\u061b\u037e"
private static final String
" \u3000\u303f"
private static final int
2
private static final int
5
private static final int
0
private static final int
4
private static final int
3
private static final int
1
-
com.itextpdf.kernel.xmp.impl.xpath.XMPPathModifier and TypeConstant FieldValue
public static final int
3
public static final int
4
public static final int
6
public static final int
5
public static final int
2
public static final int
-2147483648
public static final int
1
public static final int
0
public static final int
1
-
com.itextpdf.kernel.xmp.options.AliasOptionsModifier and TypeConstant FieldValue
public static final int
512
public static final int
4096
public static final int
2048
public static final int
1024
public static final int
0
-
com.itextpdf.kernel.xmp.options.IteratorOptionsModifier and TypeConstant FieldValue
public static final int
256
public static final int
1024
public static final int
512
public static final int
4096
-
com.itextpdf.kernel.xmp.options.ParseOptionsModifier and TypeConstant FieldValue
public static final int
16
public static final int
8
public static final int
32
public static final int
1
public static final int
4
-
com.itextpdf.kernel.xmp.options.PropertyOptionsModifier and TypeConstant FieldValue
public static final int
512
public static final int
4096
public static final int
2048
public static final int
1024
public static final int
536870912
public static final int
64
public static final int
16
public static final int
128
public static final int
0
public static final int
32
public static final int
-2147483648
public static final int
1073741824
public static final int
256
public static final int
2
-
com.itextpdf.kernel.xmp.options.SerializeOptionsModifier and TypeConstant FieldValue
public static final int
2
public static final int
3
public static final int
0
private static final int
3
public static final int
512
public static final int
256
private static final int
1
public static final int
16
public static final int
4096
public static final int
32
public static final int
8192
public static final int
128
public static final int
64
private static final int
2
-
com.itextpdf.layout.borders.BorderModifier and TypeConstant FieldValue
public static final int
5
public static final int
6
public static final int
7
public static final int
8
private static final int
270
private static final int
180
private static final int
-90
private static final int
0
private static final int
90
public static final int
1
public static final int
9
public static final int
2
public static final int
3
public static final int
4
public static final int
0
-
com.itextpdf.layout.borders.DashedBorderModifier and TypeConstant FieldValue
private static final float
5.0f
private static final float
3.5f
-
com.itextpdf.layout.borders.DottedBorder
-
com.itextpdf.layout.borders.FixedDashedBorder
-
com.itextpdf.layout.borders.RoundDotsBorder
-
com.itextpdf.layout.element.List
-
com.itextpdf.layout.exceptions.LayoutExceptionMessageConstantModifier and TypeConstant FieldValue
public static final String
"The large table was completed. It\'s prohibited to use it anymore. Created different Table instance instead."
public static final String
"Cannot create layout image by WmfImage instance. First convert the image into FormXObject and then use the corresponding layout image constructor."
public static final String
"Cannot draw elements on already flushed pages."
public static final String
"Document was closed. It is impossible to execute action."
public static final String
"Flex basis cannot be null."
public static final String
"Flex grow cannot be negative."
public static final String
"Flex shrink cannot be negative."
public static final String
"Flexible values aren\'t allowed as minimum in minmax grid function."
public static final String
"FontProvider and FontSet are empty. Cannot resolve font family name (see ElementPropertyContainer#setFontFamily) without initialized FontProvider (see RootElement#setFontProvider)."
public static final String
"Automatic repetitions in the grid template are allowed only once per template."
public static final String
"Automatic repetitions in the grid template cannot be combined with intrinsic or flexible sizes."
public static final String
"Inline vertical alignment \"{0}\" doesn\'t need a value"
public static final String
"Invalid column-count/column-width/column-gap properties, they\'re absent or have negative value"
public static final String
"Invalid FONT property value type."
public static final String
"I/O exception while creating Font"
public static final String
"A noninvertible matrix has been parsed. The behaviour is unpredictable."
public static final String
"Role \"{0}\" in namespace {1} is not mapped to any standard role."
public static final String
"Role \"{0}\" is not mapped to any standard role."
public static final String
"TaggingHintKey should have accessibility properties"
-
com.itextpdf.layout.font.FontProvider
-
com.itextpdf.layout.font.FontSelectorModifier and TypeConstant FieldValue
private static final int
5
private static final int
5
private static final int
5
private static final int
3
private static final int
3
private static final int
1
private static final int
1
private static final int
1
private static final int
13
-
com.itextpdf.layout.hyphenation.ByteVector
-
com.itextpdf.layout.hyphenation.CharVector
-
com.itextpdf.layout.hyphenation.HyphenationConstants
-
com.itextpdf.layout.hyphenation.Hyphenator
-
com.itextpdf.layout.hyphenation.PatternParserModifier and TypeConstant FieldValue
static final int
1
static final int
2
static final int
4
static final int
3
-
com.itextpdf.layout.hyphenation.TernaryTree
-
com.itextpdf.layout.layout.LayoutPosition
-
com.itextpdf.layout.layout.LayoutResult
-
com.itextpdf.layout.logs.LayoutLogMessageConstantModifier and TypeConstant FieldValue
public static final String
"Element does not fit current area. {0}"
-
com.itextpdf.layout.minmaxwidth.MinMaxWidthUtils
-
com.itextpdf.layout.properties.BackgroundPositionModifier and TypeConstant FieldValue
private static final double
9.999999747378752E-5
private static final int
100
private static final int
50
-
com.itextpdf.layout.properties.LeadingModifier and TypeConstant FieldValue
public static final int
1
public static final int
2
-
com.itextpdf.layout.properties.LineHeightModifier and TypeConstant FieldValue
private static final int
1
private static final int
2
private static final int
4
-
com.itextpdf.layout.properties.PropertyModifier and TypeConstant FieldValue
public static final int
1
public static final int
137
public static final int
130
public static final int
134
public static final int
129
public static final int
82
public static final int
2
public static final int
3
public static final int
4
public static final int
5
public static final int
6
public static final int
90
public static final int
7
public static final int
8
public static final int
9
public static final int
10
public static final int
113
public static final int
112
public static final int
114
public static final int
11
public static final int
101
public static final int
12
public static final int
13
public static final int
110
public static final int
111
public static final int
14
public static final int
105
public static final int
119
public static final int
15
public static final int
100
public static final int
89
public static final int
16
public static final int
138
public static final int
143
public static final int
144
public static final int
142
public static final int
17
public static final int
86
public static final int
87
public static final int
18
public static final int
131
public static final int
139
public static final int
132
public static final int
127
public static final int
128
public static final int
99
public static final int
19
public static final int
20
public static final int
21
public static final int
22
public static final int
91
public static final int
23
public static final int
98
public static final int
24
public static final int
94
public static final int
95
public static final int
26
public static final int
25
public static final int
152
public static final int
151
public static final int
147
public static final int
155
public static final int
148
public static final int
154
public static final int
149
public static final int
156
public static final int
150
public static final int
145
public static final int
146
public static final int
27
public static final int
28
public static final int
115
public static final int
29
public static final int
30
public static final int
126
public static final int
96
public static final int
97
public static final int
136
public static final int
31
public static final int
133
public static final int
32
public static final int
81
public static final int
33
public static final int
34
public static final int
35
public static final int
124
public static final int
88
public static final int
36
public static final int
37
public static final int
38
public static final int
39
public static final int
120
public static final int
83
public static final int
42
public static final int
41
public static final int
40
public static final int
43
public static final int
44
public static final int
45
public static final int
46
public static final int
84
private static final int
156
public static final int
79
public static final int
135
public static final int
85
public static final int
80
public static final int
118
public static final int
125
public static final int
92
public static final int
121
public static final int
106
public static final int
107
public static final int
102
public static final int
103
public static final int
104
public static final int
47
public static final int
48
public static final int
49
public static final int
50
public static final int
51
public static final int
52
public static final int
123
public static final int
54
public static final int
55
public static final int
56
public static final int
57
public static final int
58
public static final int
59
public static final int
153
public static final int
60
public static final int
65
public static final int
61
public static final int
62
public static final int
63
public static final int
64
public static final int
66
public static final int
67
public static final int
68
public static final int
69
public static final int
93
public static final int
108
public static final int
109
public static final int
70
public static final int
71
public static final int
72
public static final int
73
public static final int
53
public static final int
140
public static final int
141
public static final int
117
public static final int
74
public static final int
75
public static final int
116
public static final int
76
public static final int
122
public static final int
77
public static final int
78
-
com.itextpdf.layout.properties.UnitValue
-
com.itextpdf.layout.renderer.AbstractRendererModifier and TypeConstant FieldValue
private static final int
270
private static final int
180
private static final int
-90
private static final int
0
private static final int
90
static final int
2
protected static final float
9.999999747378752E-5f
protected static final float
1000000.0f
static final int
3
public static final float
9.999999747378752E-5f
static final int
1
static final int
0
-
com.itextpdf.layout.renderer.com.itextpdf.layout.renderer.BackgroundSizeCalculationUtil
-
com.itextpdf.layout.renderer.com.itextpdf.layout.renderer.FlexUtilModifier and TypeConstant FieldValue
private static final float
9.999999747378752E-5f
private static final float
0.0f
private static final float
1.0f
-
com.itextpdf.layout.renderer.com.itextpdf.layout.renderer.InlineVerticalAlignmentHelperModifier and TypeConstant FieldValue
private static final float
0.0010000000474974513f
private static final float
-0.20000000298023224f
private static final float
0.30000001192092896f
-
com.itextpdf.layout.renderer.com.itextpdf.layout.renderer.LineHeightHelperModifier and TypeConstant FieldValue
public static final int
0
private static final float
1.149999976158142f
public static final int
1
public static final int
3
public static final int
2
-
com.itextpdf.layout.renderer.LineRendererModifier and TypeConstant FieldValue
private static final float
0.0010000000474974513f
-
com.itextpdf.layout.renderer.MulticolRenderer
-
com.itextpdf.layout.renderer.com.itextpdf.layout.renderer.TableWidths.CellInfo
-
com.itextpdf.layout.renderer.TextPreprocessingUtilModifier and TypeConstant FieldValue
static final int
3
static final int
500
static final int
200
-
com.itextpdf.layout.renderer.TextRendererModifier and TypeConstant FieldValue
private static final float
0.03333333507180214f
private static final float
0.2125599980354309f
protected static final float
1000.0f
static final float
1.2000000476837158f
static final int
2147483647
-
com.itextpdf.layout.renderer.com.itextpdf.layout.renderer.TextSequenceWordWrappingModifier and TypeConstant FieldValue
private static final float
9.999999747378752E-5f
-
com.itextpdf.layout.renderer.TypographyUtils
-
com.itextpdf.layout.tagging.LayoutTaggingHelperModifier and TypeConstant FieldValue
private final int
-1
private final int
-2
-
com.itextpdf.pdfa.PdfAXMPUtilModifier and TypeConstant FieldValue
public static final String
" <x:xmpmeta xmlns:x=\"adobe:ns:meta/\">\n <rdf:RDF xmlns:rdf=\"http://www.w3.org/1999/02/22-rdf-syntax-ns#\">\n <rdf:Description rdf:about=\"\" xmlns:pdfaExtension=\"http://www.aiim.org/pdfa/ns/extension/\" xmlns:pdfaSchema=\"http://www.aiim.org/pdfa/ns/schema#\" xmlns:pdfaProperty=\"http://www.aiim.org/pdfa/ns/property#\">\n <pdfaExtension:schemas>\n <rdf:Bag>\n <rdf:li rdf:parseType=\"Resource\">\n <pdfaSchema:namespaceURI rdf:resource=\"http://www.aiim.org/pdfua/ns/id/\"/>\n <pdfaSchema:prefix>pdfuaid</pdfaSchema:prefix>\n <pdfaSchema:schema>PDF/UA identification schema</pdfaSchema:schema>\n <pdfaSchema:property>\n <rdf:Seq>\n <rdf:li rdf:parseType=\"Resource\">\n <pdfaProperty:category>internal</pdfaProperty:category>\n <pdfaProperty:description>PDF/UA version identifier</pdfaProperty:description>\n <pdfaProperty:name>part</pdfaProperty:name>\n <pdfaProperty:valueType>Integer</pdfaProperty:valueType>\n </rdf:li>\n <rdf:li rdf:parseType=\"Resource\">\n <pdfaProperty:category>internal</pdfaProperty:category>\n <pdfaProperty:description>PDF/UA amendment identifier</pdfaProperty:description>\n <pdfaProperty:name>amd</pdfaProperty:name>\n <pdfaProperty:valueType>Text</pdfaProperty:valueType>\n </rdf:li>\n <rdf:li rdf:parseType=\"Resource\">\n <pdfaProperty:category>internal</pdfaProperty:category>\n <pdfaProperty:description>PDF/UA corrigenda identifier</pdfaProperty:description>\n <pdfaProperty:name>corr</pdfaProperty:name>\n <pdfaProperty:valueType>Text</pdfaProperty:valueType>\n </rdf:li>\n </rdf:Seq>\n </pdfaSchema:property>\n </rdf:li>\n </rdf:Bag>\n </pdfaExtension:schemas>\n </rdf:Description>\n </rdf:RDF>\n </x:xmpmeta>"
-
com.itextpdf.pdfa.checker.PdfA1CheckerModifier and TypeConstant FieldValue
private static final int
8
-
com.itextpdf.pdfa.checker.PdfA2CheckerModifier and TypeConstant FieldValue
private static final int
32
static final int
14400
static final int
3
private static final String
"If the document does not contain a OutputIntent, then page with transparency shall include the dictionary with Group key that include a CS with blending colour space"
-
com.itextpdf.pdfa.checker.PdfA4CheckerModifier and TypeConstant FieldValue
private static final String
"CalRGB"
private static final String
"If the document does not contain a PDF/A output intent, then all pages that contain transparency shall either have a page-level PDF/A output intent or the page dictionary shall include the Group key, and the attribute dictionary that forms the value of that Group key shall include a CS entry whose value shall be used as the default blending colour space."
-
com.itextpdf.pdfa.checker.PdfAChecker
-
com.itextpdf.pdfa.exceptions.PdfAConformanceExceptionModifier and TypeConstant FieldValue
public static final String
"{0} actions are not allowed"
public static final String
"A catalog dictionary shall contain metadata entry"
public static final String
"A catalog dictionary shall not contain aa entry"
public static final String
"A catalog dictionary shall not contain alternatepresentations names entry"
public static final String
"A catalog dictionary shall not contain the ocproperties key"
public static final String
"A catalog dictionary shall not contain a requirements entry"
public static final String
"A catalog dictionary shall include a markinfo dictionary whose entry marked shall have a value of true"
public static final String
"A form xobject dictionary shall not contain opi key"
public static final String
"A form xobject dictionary shall not contain PS key"
public static final String
"A form xobject dictionary shall not contain subtype2 key with a value of PS"
public static final String
"A group object with an s key with a value of transparency shall not be included in a form xobject"
public static final String
"A group object with an s key with a value of transparency shall not be included in a page xobject"
public static final String
"A name dictionary shall not contain the EmbeddedFiles key"
public static final String
"All colour channels in the jpeg2000 data shall have the same bit-depth"
public static final String
"All halftones shall have halftonetype 1 or 5"
public static final String
"All non-symbolic TrueType fonts shall specify MacRomanEncoding or WinAnsiEncoding as the value of the Encoding entry in the font dictionary "
public static final String
"All non-symbolic TrueType fonts shall specify MacRomanEncoding or WinAnsiEncoding as the value of the Encoding entry in the font dictionary This also means that Encoding entry in the font dictionary shall not be an encoding dictionary "
public static final String
"All symbolic TrueType fonts shall not specify an Encoding entry in the font dictionary "
public static final String
"All the fonts must be embedded. This one is not: {0}"
public static final String
"An annotation dictionary shall contain the f key"
public static final String
"An annotation dictionary shall not contain aa key"
public static final String
"An annotation dictionary shall not contain the ca key with a value other than 1"
public static final String
"An extgstate dictionary shall not contain the HTP key"
public static final String
"An extgstate dictionary shall not contain the TR2 key with a value other than default"
public static final String
"An extgstate dictionary shall not contain the tr key"
public static final String
"An image dictionary shall not contain alternates key"
public static final String
"An image dictionary shall not contain opi key"
public static final String
"Annotation of type {0} should have contents key"
public static final String
"Annotation type {0} is not permitted"
public static final String
"Appearance dictionary of widget subtype and btn field type shall contain only the n key with dictionary value"
public static final String
"Appearance dictionary shall contain only the n key with stream value"
public static final String
"Blend mode shall have value normal or compatible"
public static final String
"Color space {0} shall be device independent"
public static final String
"Color space {0} shall have {1} components"
public static final String
"Crypt filter is not permitted inline image"
public static final String
"Deprecated setstate and noop actions are not allowed"
public static final String
"Destoutputprofile in the pdfa1 outputintent dictionary shall be rgb"
public static final String
"Devicecmyk may be used only if the file has a cmyk pdfa outputIntent"
public static final String
"Devicecmyk may be used only if the file has a cmyk pdfa outputIntent or defaultcmyk in usage context"
public static final String
"Devicergb and devicecmyk colorspaces cannot be used both in one file"
public static final String
"Devicergb may be used only if the file has a rgb pdfa outputIntent"
public static final String
"Devicergb may be used only if the file has a rgb pdfa outputIntent or defaultrgb in usage context"
public static final String
"Document to read from shall be a pdfa conformant file with valid xmp metadata"
public static final String
"Ef key of file specification dictionary shall contain dictionary with valid f key"
public static final String
"Embedded file shall contain params key with dictionary as value"
public static final String
"Embedded file shall contain params key with valid moddate key"
public static final String
"Every annotation shall have at least one appearance dictionary"
public static final String
"Exactly one colour space specification shall have the value 0x01 in the approx field"
public static final String
"File specification dictionary shall contain f key and uf key"
public static final String
"File specification dictionary shall contain one of the predefined afrelationship keys"
public static final String
"File specification dictionary shall not contain the EF key"
public static final String
"Graphics state stack depth is greater than 28"
public static final String
"Halftones shall not contain halftonename"
public static final String
"If device rgb cmyk gray used in file, that file shall contain pdfa outputintent"
public static final String
"If device rgb cmyk gray used in file that file shall contain pdfa outputintent or DefaultRgb Cmyk Gray in usage context"
public static final String
"If outputintents array has more than one entry with destoutputprofile key the same indirect object shall be used as the value of that object"
public static final String
"If specified rendering shall be one of the following relativecolorimetric absolutecolorimetric perceptual or saturation"
public static final String
"Integer number is out of range"
public static final String
"jpeg2000 enumerated colour space 19 (CIEJab) shall not be used"
public static final String
"Keyword encrypt shall not be used in the trailer dictionary"
public static final String
"LZWDecode filter is not permitted"
public static final String
"Maximum array capacity is exceeded"
public static final String
"Maximum dictionary capacity is exceeded"
public static final String
"Maximum number of indirect objects exceeded"
public static final String
"Mime type shall be specified using the subtype key of the file specification stream dictionary"
public static final String
"If an annotation dictionary\'s Subtype key has a value of Widget and its FT key has a value of Btn, the value of the N key shall be an appearance subdictionary"
public static final String
"Named action type {0} not allowed"
public static final String
"Needappearances flag of the interactive form dictionary shall either not be presented or shall be false"
public static final String
"No keys other than UR3 and DocMDP shall be present in a permissions dictionary"
public static final String
"Not identity crypt filter is not permitted"
public static final String
"Only jpx baseline set of features shall be used"
public static final String
"Only standard blend modes shall be used for the value of the BM key in an extended graphic state dictionary"
public static final String
"Optional content configuration dictionary shall contain name entry"
public static final String
"Order array shall contain references to all ocgs"
public static final String
"Output intent color space shall be either gray rgb or cmyk"
public static final String
"Overprint mode shall not be one when an ICCBased CMYK colour space is used and when overprinting is set to true"
public static final String
"PdfName is too long"
public static final String
"PdfString is too long"
public static final String
"Profile stream of outputintent shall be output profile (prtr) or monitor profile (mntr)"
public static final String
"Real number is out of range"
public static final String
"Signature references dictionary shall not contain digestlocation digestmethod digestvalue"
public static final String
"Stream object dictionary shall not contain the f ffilter or fdecodeparams keys"
public static final String
"The as key shall not appear in any optional content configuration dictionary"
public static final String
"The bit-depth of the jpeg2000 data shall have a value in the range 1 to 38"
public static final String
"The catalog dictionary shall not contain the needsrendering key"
public static final String
"If the document does not contain a OutputIntent, then page with transparency shall include the dictionary with Group key that include a CS with blending colour space"
public static final String
"The f keys print flag bit shall be set to 1 and its hidden invisible and noview flag bits shall be set to 0"
public static final String
"The f keys print flag bit shall be set to 1 and its hidden invisible noview and togglenoview flag bits shall be set to 0"
public static final String
"The interactive form dictionary shall not contain the xfa key"
public static final String
"The number of color components in DeviceN colorspace should not exceed {0}"
public static final String
"The number of colour channels in the jpeg2000 data shall be 1, 3 or 4"
public static final String
"The page dictionary shall not contain aa entry"
public static final String
"The page dictionary shall not contain pressteps entry"
public static final String
"The page is less than 3 units or greater than 14400 in either direction"
public static final String
"The smask key is not allowed in extgstate"
public static final String
"The smask key is not allowed in xobjects"
public static final String
"The value of interpolate key shall not be true"
public static final String
"The value of the meth entry in colr box shall be 1, 2 or 3"
public static final String
"TintTransform and alternateSpace shall be the same for the all separation cs with the same name"
public static final String
"Transparency is not allowed. ca shall be equal to 1"
public static final String
"Transparency is not allowed. CA shall be equal to 1"
public static final String
"Value of name entry shall be unique among all optional content configuration dictionaries"
public static final String
"Widget annotation dictionary or field dictionary shall not include a or aa entry"
-
com.itextpdf.pdfa.exceptions.PdfaExceptionMessageConstantModifier and TypeConstant FieldValue
public static final String
"{0} actions are not allowed"
public static final String
"A catalog dictionary shall contain metadata entry"
public static final String
"A catalog dictionary shall not contain aa entry"
public static final String
"A catalog dictionary shall not contain alternatepresentations names entry"
public static final String
"A catalog dictionary shall not contain the ocproperties key"
public static final String
"A catalog dictionary shall not contain a requirements entry"
public static final String
"A catalog dictionary shall include a markinfo dictionary whose entry marked shall have a value of true"
public static final String
"A form xobject dictionary shall not contain opi key"
public static final String
"A form xobject dictionary shall not contain PS key"
public static final String
"A form xobject dictionary shall not contain ref key"
public static final String
"A form xobject dictionary shall not contain subtype2 key with a value of PS"
public static final String
"A group object with an s key with a value of transparency shall not be included in a form xobject"
public static final String
"A group object with an s key with a value of transparency shall not be included in a page xobject"
public static final String
"A name dictionary shall not contain the EmbeddedFiles key"
public static final String
"All colour channels in the jpeg2000 data shall have the same bit-depth"
public static final String
"The TransferFunction key in a halftone dictionary can only be present if it is a component in a Type 5 halftone dictionary representing a colorant other than Cyan, Magenta, Yellow or Black."
public static final String
"All halftones shall have halftonetype 1 or 5"
public static final String
"All non-symbolic TrueType fonts shall specify MacRomanEncoding or WinAnsiEncoding as the value of the Encoding entry in the font dictionary "
public static final String
"All non-symbolic TrueType fonts shall specify MacRomanEncoding or WinAnsiEncoding as the value of the Encoding entry in the font dictionary This also means that Encoding entry in the font dictionary shall not be an encoding dictionary "
public static final String
"All symbolic TrueType fonts shall not specify an Encoding entry in the font dictionary "
public static final String
"All the fonts must be embedded. This one is not: {0}"
public static final String
"An annotation dictionary shall contain the f key"
public static final String
"An annotation dictionary shall not contain aa key"
public static final String
"An annotation dictionary shall not contain the ca key with a value other than 1"
public static final String
"An extgstate dictionary shall not contain the HTP key"
public static final String
"An extgstate dictionary shall not contain the TR2 key with a value other than default"
public static final String
"An extgstate dictionary shall not contain the tr key"
public static final String
"An image dictionary shall not contain alternates key"
public static final String
"An image dictionary shall not contain opi key"
public static final String
"If annotation dictionary (other than a Widget annotation dictionary) includes an AA entry, its value (which is an additional-actions dictionary) shall only contain keys from the following list: E, X, D, U, Fo, and B"
public static final String
"Annotation type {0} is not permitted"
public static final String
"Appearance dictionary of widget subtype and btn field type shall contain only the n key with dictionary value"
public static final String
"Appearance dictionary shall contain only the n key with stream value"
public static final String
"Blend mode shall have value normal or compatible"
public static final String
"Can\'t find an appropriate checker for a specified name."
public static final String
"Cannot parse content stream."
public static final String
"If a document catalog dictionary includes an AA entry, its value (which is an additional-actions dictionary) shall only contain keys from the following list: E, X, D, U, Fo, and B"
public static final String
"Color space {0} shall be device independent"
public static final String
"Color space {0} shall have {1} components"
public static final String
"For any spot color used in a DeviceN or NChannel colorspace, an entry in the Colorants dictionary shall be present."
public static final String
"Crypt filter is not permitted inline image"
public static final String
"Deprecated setstate and noop actions are not allowed"
public static final String
"Destoutputprofile in the pdfa1 outputintent dictionary shall be rgb"
public static final String
"Devicecmyk may be used only if the file has a cmyk pdfa outputIntent"
public static final String
"Devicecmyk may be used only if the file has a cmyk pdfa outputIntent or defaultcmyk in usage context"
public static final String
"DeviceCMYK shall only be used if a device independent DefaultCMYK colour space has been set when the DeviceCMYK colour space is used or if the current transparency blending space, when the DeviceCMYK colour space is used, is a device independent CMYK-based colour space or the current PDF/A OutputIntent, when the DeviceCMYK colour space is used, contains a \u2018CMYK\u2019 destination profile."
public static final String
"DeviceGray shall only be used if a device independent DefaultGray colour space has been set when the DeviceGray colour space is used, or if a PDF/A OutputIntent is in effect."
public static final String
"Devicergb and devicecmyk colorspaces cannot be used both in one file"
public static final String
"Devicergb may be used only if the file has a rgb pdfa outputIntent"
public static final String
"Devicergb may be used only if the file has a rgb pdfa outputIntent or defaultrgb in usage context"
public static final String
"DeviceRGB shall only be used if a device independent DefaultRGB colour space has been set when the DeviceRGB colour space is used or if the current transparency blending space, when the DeviceRGB colour space is used, is a device independent RGB-based colour space or the current PDF/A OutputIntent, when the DeviceRGB colour space is used, contains an \u2018RGB \u2019 destination profile."
public static final String
"If a document information dictionary is present, it shall only contain a ModDate entry."
public static final String
"The Info key shall not be present in the trailer dictionary of PDF/A-4 conforming files unless there exists a PieceInfo entry in the document catalog dictionary."
public static final String
"Document to read from shall be a pdfa conformant file with valid xmp metadata"
public static final String
"Ef key of file specification dictionary shall contain dictionary with valid f key"
public static final String
"Embedded file shall contain params key with dictionary as value"
public static final String
"Embedded file shall contain params key with valid moddate key"
public static final String
"Embedded fonts shall define all glyphs referenced for rendering within the conforming file."
public static final String
"Every annotation shall have at least one appearance dictionary"
public static final String
"Exactly one colour space specification shall have the value 0x01 in the approx field"
public static final String
"Each embedded file\u2019s file specification dictionary shall contain an AFRelationship key."
public static final String
"File specification dictionary shall contain f key and uf key"
public static final String
"File specification dictionary shall contain one of the predefined afrelationship keys"
public static final String
"File specification dictionary shall not contain the EF key"
public static final String
"Graphics state stack depth is greater than 28"
public static final String
"Halftones shall not contain halftonename"
public static final String
"An ICCBased colour space shall not be used where the profile is a CMYK destination profile and is identical to that in the current PDF/A OutputIntent or the current transparency blending colorspace."
public static final String
"If device rgb cmyk gray used in file, that file shall contain pdfa outputintent"
public static final String
"If device rgb cmyk gray used in file that file shall contain pdfa outputintent or DefaultRgb Cmyk Gray in usage context"
public static final String
"If outputintents array has more than one entry with destoutputprofile key the same indirect object shall be used as the value of that object"
public static final String
"If specified rendering shall be one of the following relativecolorimetric absolutecolorimetric perceptual or saturation"
public static final String
"Integer number is out of range"
public static final String
"Filters that are not listed in ISO 32000-2:\u2014, 8.9.7, Table 92 or an array containing any such value shall not be used."
public static final String
"Filters that are not listed in ISO 32000-2:\u2014, 7.4, Table 6 shall not be used."
public static final String
"XMP metadata shall always be UTF-8 encoded."
public static final String
"jpeg2000 enumerated colour space 19 (CIEJab) shall not be used"
public static final String
"Keyword encrypt shall not be used in the trailer dictionary"
public static final String
"LZWDecode filter is not permitted"
public static final String
"Maximum array capacity is exceeded"
public static final String
"Maximum dictionary capacity is exceeded"
public static final String
"Maximum number of indirect objects exceeded"
public static final String
"Mime type shall be specified using the subtype key of the file specification stream dictionary"
public static final String
"If an annotation dictionary\'s Subtype key has a value of Widget and its FT key has a value of Btn, the value of the N key shall be an appearance subdictionary"
public static final String
"Conforming file shall contain an EmbeddedFiles key in the name dictionary of the document catalog dictionary."
public static final String
"Named action type {0} not allowed"
public static final String
"Needappearances flag of the interactive form dictionary shall either not be presented or shall be false"
public static final String
"No keys other than UR3 and DocMDP shall be present in a permissions dictionary"
public static final String
"Not identity crypt filter is not permitted"
public static final String
"Only jpx baseline set of features shall be used"
public static final String
"Only blend modes that are specified in ISO 32000-2:2020 shall be used for the value of the BM key in a graphic state dictionary or an annotation dictionary."
public static final String
"Only standard blend modes shall be used for the value of the BM key in an extended graphic state dictionary"
public static final String
"Optional content configuration dictionary shall contain name entry"
public static final String
"Order array shall contain references to all ocgs"
public static final String
"Output intent color space shall be either gray rgb or cmyk"
public static final String
"DestOutputProfileRef shall not be present in output intent"
public static final String
"Overprint mode shall not be one when an ICCBased CMYK colour space is used and when overprinting is set to true"
public static final String
"If page dictionary includes an AA entry, its value (which is an additional-actions dictionary) shall only contain keys from the following list: E, X, D, U, Fo, and B"
public static final String
"PdfName is too long"
public static final String
"PdfString is too long"
public static final String
"Profile stream of outputintent shall be output profile (prtr) or monitor profile (mntr)"
public static final String
"Real number is out of range"
public static final String
"Signature references dictionary shall not contain digestlocation digestmethod digestvalue"
public static final String
"Signature shall conform to one of the PAdES profiles from either ISO 32000-2 or ISO 14533-3."
public static final String
"Stream object dictionary shall not contain the f ffilter or fdecodeparams keys"
public static final String
"The as key shall not appear in any optional content configuration dictionary"
public static final String
"The bit-depth of the jpeg2000 data shall have a value in the range 1 to 38"
public static final String
"The catalog dictionary shall not contain the needsrendering key"
public static final String
"The catalog version key shall begin at byte zero and shall consist of \u201c%PDF-{0}.n\u201d"
public static final String
"If the document does not contain a PDF/A output intent, then all pages that contain transparency shall either have a page-level PDF/A output intent or the page dictionary shall include the Group key, and the attribute dictionary that forms the value of that Group key shall include a CS entry whose value shall be used as the default blending colour space."
public static final String
"If the document does not contain a OutputIntent, then page with transparency shall include the dictionary with Group key that include a CS with blending colour space"
public static final String
"The f keys print flag bit shall be set to 1 and its hidden invisible and noview flag bits shall be set to 0"
public static final String
"The f keys print flag bit shall be set to 1 and its hidden invisible noview and togglenoview flag bits shall be set to 0"
public static final String
"The file header shall begin at byte zero and shall consist of \u201c%PDF-{0}.n\u201d"
public static final String
"The interactive form dictionary shall not contain the xfa key"
public static final String
"The number of color components in DeviceN colorspace should not exceed {0}"
public static final String
"The number of colour channels in the jpeg2000 data shall be 1, 3 or 4"
public static final String
"The page dictionary shall not contain aa entry"
public static final String
"The page dictionary shall not contain pressteps entry"
public static final String
"The page is less than 3 units or greater than 14400 in either direction"
public static final String
"The smask key is not allowed in extgstate"
public static final String
"The smask key is not allowed in xobjects"
public static final String
"The value of interpolate key shall not be true"
public static final String
"The value of the meth entry in colr box shall be 1, 2 or 3"
public static final String
"TintTransform and alternateSpace shall be the same for the all separation cs with the same name"
public static final String
"Transparency is not allowed. ca shall be equal to 1"
public static final String
"Transparency is not allowed. CA shall be equal to 1"
public static final String
"Value of name entry shall be unique among all optional content configuration dictionaries"
public static final String
"Widget annotation dictionary or field dictionary shall not include a entry"
public static final String
"Widget annotation dictionary or field dictionary shall not include a or aa entry"
public static final String
"XMP metadata header packet may not contain bytes or encoding attribute."
public static final String
"XMP metadata header shall contain version identifier pdfaid:rev F or E or absent if no conformance level is specified"
public static final String
"XMP metadata header shall contain version identifier pdfaid:part with value {0}"
public static final String
"XMP metadata header shall contain version identifier pdfaid:rev with four digit integer value"
public static final String
"XMP metadata history entry shall contain key {0}"
-
com.itextpdf.pdfa.logs.PdfAConformanceLogMessageConstantModifier and TypeConstant FieldValue
public static final String
"Annotation of type {0} should have contents key"
public static final String
"Catalog dictionary should contain lang entry"
public static final String
"Embedded file shall be compliant with either ISO 19005-1 (PDF-A/1 standard) or ISO 19005-2 (PDF-A/2 standard). Please ensure that fact, because iText doesn\'t check embedded file."
public static final String
"Embedded file should contain params key "
public static final String
"File specification dictionary should contain desc key"
public static final String
"Text annotations should set the nozoom and norotate flag bits of the f key to 1"
public static final String
"TintTransform and alternateSpace of separation arrays in the colorants of deviceN should be consistent with same attributes of deviceN"
-
com.itextpdf.pdfa.logs.PdfALogMessageConstantModifier and TypeConstant FieldValue
public static final String
"Object flushing was not performed. Object in PDF/A mode can only be flushed if the document is closed or if this object has already been checked for compliance with PDF/A rules."
public static final String
"Page flushing was not performed. Pages flushing in PDF/A mode works only with explicit calls to PdfPage#flush(boolean) with flushResourcesContentStreams argument set to true"
-
com.itextpdf.pdfua.checkers.utils.XfaCheckUtil
-
com.itextpdf.pdfua.exceptions.PdfUAExceptionMessageConstantsModifier and TypeConstant FieldValue
public static final String
"Annotations of subtype TrapNet shall not be permitted."
public static final String
"Annotation of type {0} should have contents or alternate description."
public static final String
"Content marked as artifact may only reside in Artifact content."
public static final String
"TD cell row:{0} col:{1} in table {2} does not contain a valid Headers attribute, and Headers for this cell cannot be determined algorithmically."
public static final String
"Cell: row {0} ({1}) col {2} has invalid role."
public static final String
"Content is neither marked as Artifact nor tagged as real content."
public static final String
"Content with MCID, but MCID wasn\'t found in StructTreeRoot."
public static final String
"CT or Alt entry is missing from the media clip data dictionary."
public static final String
"Document does not contain valid lang entry."
public static final String
"Document shall contain a XMP metadata stream."
public static final String
"Document uses both H and H# tags."
public static final String
"Dynamic XFA forms shall not be used."
public static final String
"File specification dictionary shall contain f key and uf key."
public static final String
"Following font(s) are not embedded: {0}"
public static final String
"Formula tags shall include an alternative representation or replacement text."
public static final String
"The \'{0}\' glyph either isn\'t defined in embedded font or doesn\'t have unicode mapping."
public static final String
"Heading level 1 is skipped in a descending sequence of header levels."
public static final String
"Heading level {0} is skipped in a descending sequence of header levels."
public static final String
"Figure tags shall include an alternative representation or replacement text. call com.itextpdf.kernel.pdf.tagutils.AccessibilityProperties#setActualText or com.itextpdf.kernel.pdf.tagutils.AccessibilityProperties#setAlternateDescription to be PDF/UA compliant."
public static final String
"Specified document pdf version isn\'t supported in pdf/ua."
public static final String
"A link annotation is not nested within a <Link> tag."
public static final String
"Annotation of type Link shall contain an alternate description via their Contents key."
public static final String
"Metadata shall be present in the catalog dictionary"
public static final String
"Metadata shall contain dc:title entry."
public static final String
"Metadata shall contain correct pdfuaid:part version identifier."
public static final String
"Document form fields missing both TU entry and alternative description. For PdfFormfields use PdfFormfield#setAlternativeName(\"Your alternative description\"); For the layout engine use Element#getAccesibilityProperties().setAlternateDescription(\"your alternative description\")"
public static final String
"ViewerPreferences dictionary of the Catalog dictionary does not contain a DisplayDocTitle entry."
public static final String
"A node contains more than one H tag."
public static final String
"Name entry is missing or has an empty string as its value in an Optional Content Configuration Dictionary."
public static final String
"ID entry \'{0}\' shall be unique among all elements in the document\u2019s structure hierarchy"
public static final String
"Note tags shall include a unique ID entry."
public static final String
"Optional Content properties configs shall be an array."
public static final String
"An AS entry appears in an Optional Content."
public static final String
"One or more standard types are remapped."
public static final String
"Permissions are absent in pdf encryption dictionary."
public static final String
"A page with annotation(s) doesn\'t contains Tabs key with S value."
public static final String
"Annotations of subtype PrinterMark shall not be included in logical structure."
public static final String
"Content marked as content may not reside in Artifact content."
public static final String
"Tagged content is present inside content marked as Artifact or vice versa."
public static final String
"Suspects entry in mark info dictionary shall not have a value of true."
public static final String
"Cell: row {0} ({1}) col {2} is empty, each row should have the same amount of columns when taking into account spanning."
public static final String
"Tag hasn\'t been added before adding content to the canvas."
public static final String
"\"{0}\" tag mapping does not terminate with a standard type."
public static final String
"10th bit of P value of Encryption dictionary should be 1 if the document is tagged."
public static final String
"ViewerPreferences dictionary of the Catalog dictionary contains a DisplayDocTitle entry with a value of false."
-
com.itextpdf.pdfua.exceptions.PdfUALogMessageConstantsModifier and TypeConstant FieldValue
public static final String
"Page flushing is disabled in PDF/UA mode to allow UA checks to be applied. Page will only be flushed on closing."
-
com.itextpdf.signatures.CertificateVerification
-
com.itextpdf.signatures.DigestAlgorithmsModifier and TypeConstant FieldValue
public static final String
"RIPEMD160"
public static final String
"SHA-1"
public static final String
"SHA-256"
public static final String
"SHA3-256"
public static final String
"SHA3-384"
public static final String
"SHA3-512"
public static final String
"SHA-384"
public static final String
"SHA-512"
public static final String
"SHAKE256"
-
com.itextpdf.signatures.OCSPVerifier
-
com.itextpdf.signatures.OID.X509ExtensionsModifier and TypeConstant FieldValue
public static final String
"1.3.6.1.5.5.7.1.1"
public static final String
"2.5.29.35"
public static final String
"2.5.29.19"
public static final String
"2.5.29.32"
public static final String
"2.5.29.31"
public static final String
"2.5.29.37"
public static final String
"2.5.29.46"
public static final String
"1.3.6.1.5.5.7.3.8"
public static final String
"1.3.6.1.5.5.7.48.1.5"
public static final String
"2.5.29.54"
public static final String
"2.5.29.18"
public static final String
"2.5.29.15"
public static final String
"2.5.29.30"
public static final String
"2.5.29.36"
public static final String
"2.5.29.33"
public static final String
"2.5.29.17"
public static final String
"2.5.29.9"
public static final String
"1.3.6.1.5.5.7.1.11"
public static final String
"2.5.29.14"
public static final String
"0.4.0.194121.2.1"
-
com.itextpdf.signatures.PdfPadesSigner
-
com.itextpdf.signatures.PdfSignerModifier and TypeConstant FieldValue
public static final int
2
public static final int
3
public static final int
1
public static final int
0
-
com.itextpdf.signatures.RSASSAPSSMechanismParams
-
com.itextpdf.signatures.SecurityIDsModifier and TypeConstant FieldValue
public static final String
"1.2.840.113549.1.9.16.2.12"
public static final String
"1.2.840.113549.1.9.16.2.47"
public static final String
"1.2.840.113549.1.9.16.2.14"
public static final String
"1.2.840.113583.1.1.8"
public static final String
"1.3.6.1.5.5.7.48.2"
public static final String
"1.2.840.113549.1.9.3"
public static final String
"1.2.840.10040.4.1"
public static final String
"1.2.840.10045.2.1"
public static final String
"1.3.101.112"
public static final String
"1.3.101.113"
public static final String
"1.2.840.113549.1.9.4"
public static final String
"1.2.840.113549.1.1.8"
public static final String
"1.3.6.1.5.5.7.48.1"
public static final String
"1.2.840.113549.1.7.1"
public static final String
"1.2.840.113549.1.7.2"
public static final String
"1.3.6.1.5.5.7.16.2"
public static final String
"1.2.840.113549.1.1.1"
public static final String
"1.2.840.113549.1.1.11"
public static final String
"2.16.840.1.101.3.4.3.16"
public static final String
"1.2.840.113549.1.1.10"
public static final String
"2.16.840.1.101.3.4.2.1"
public static final String
"2.16.840.1.101.3.4.2.2"
public static final String
"2.16.840.1.101.3.4.2.3"
public static final String
"2.16.840.1.101.3.4.2.12"
public static final String
"1.2.840.113549.1.9.5"
public static final String
"1.2.840.113583.1.1.9.1"
-
com.itextpdf.signatures.com.itextpdf.signatures.SignatureUtil.ContentsChecker
-
com.itextpdf.signatures.TSAClientBouncyCastleModifier and TypeConstant FieldValue
public static final String
"SHA-256"
public static final int
10240
-
com.itextpdf.signatures.cms.SignerInfo
-
com.itextpdf.signatures.exceptions.SignExceptionMessageConstantModifier and TypeConstant FieldValue
public static final String
"{0} requires the document to be digested using {1}, not {2}"
public static final String
"Signing algorithms {0} and {1} are not supported."
public static final String
"Authenticated attribute is missing the digest."
public static final String
"Available space is not enough for signature."
public static final String
"Cannot be verified against the KeyStore or the certificate chain."
public static final String
"Cannot decode PKCS#7 SignedData object."
public static final String
"Cannot find signing certificate with serial {0}."
public static final String
"Certificate {0} failed: {1}"
public static final String
"Certification signature creation failed. Document shall not contain any certification or approval signatures before signing with certification signature."
public static final String
"Signer certificate not found in list of certificates"
public static final String
"Provided data is not a CMS container"
public static final String
"The certificate set must at least contains the signer certificate"
public static final String
"Only one signer per CMS container is allowed"
public static final String
"Signer info is not yet initialized"
public static final String
"Updating the signed attributes of this SignerInfo instance is not possible because it has been serialized or been initiated from a serialized version."
public static final String
"Could not determine OID for signature algorithm {0} with digest {1}."
public static final String
"Default implementation of OCSP and CRL clients cannot be created, because signing certificate doesn\'t contain revocation data sources. Please try to explicitly add OCSP or CRL client."
public static final String
"Dictionary key {0} is not a name."
public static final String
"Digest algorithm used in the provided IExternalSignature shall be the same as digest algorithm in the provided CMSContainer. Digest algorithm in CMS container: \"{0}\". Digest algorithm in IExternalSignature: \"{1}\""
public static final String
"Digest algorithm in MGF1 parameters is {0} while ambient digest algorithm is {1}"
public static final String
"Document has been already pre closed."
public static final String
"Document must be preClosed."
public static final String
"Document must have reader."
public static final String
"Failed to get TSA response from {0}."
public static final String
"Field has been already signed."
public static final String
"Field names cannot contain a dot."
public static final String
"Field type is not a signature field type."
public static final String
"Invalid parameters provided."
public static final String
"Invalid http response {0}."
public static final String
"Invalid state. Possible circular certificate chain."
public static final String
"Invalid TSA {0} response code {1}."
public static final String
"No crypto dictionary defined."
public static final String
"Neither ocsp nor crl data are available for the signing certificate or certificate is revoked."
public static final String
"Document doesn\'t contain any signatures to prolong."
public static final String
"Not a valid PKCS#7 object - not a sequence"
public static final String
"Not a valid PKCS#7 object - not signed data."
public static final String
"Not enough space."
public static final String
"Only MGF1 is supported in RSASSA-PSS"
public static final String
"Provided path: {0} is not a directory. Please provide a directory path to store temporary pdf files which are required for signing."
public static final String
"Provided TSA client is null. TSA client is required for timestamp signing."
public static final String
"Digest algorithm in RSASSA-PSS parameters is {0} while ambientdigest algorithm is {1}"
public static final String
"Signature with name {0} is not the last. It doesn\'t cover the whole document."
public static final String
"The name of the digest algorithm is null."
public static final String
"There is no field in the document with such name: {0}."
public static final String
"This instance of PdfSigner has been already closed."
public static final String
"This PKCS#7 object has multiple SignerInfos. Only one is supported at this time."
public static final String
"TSA {0} failed to return time stamp token: {1}."
public static final String
"Timestamp token estimation size is not large enough to accommodate the entire timestamp token. Timestamp token estimation size is: {0} bytes, however real timestamp token size is: {1} bytes."
public static final String
"The key is too big."
public static final String
"ITSAClient must be present to reach this PAdES level. Please use setTSAClient method to provide it."
public static final String
"Unexpected close bracket."
public static final String
"unexpected >>."
public static final String
"Unknown hash algorithm: {0}."
public static final String
"Verification already output."
-
com.itextpdf.signatures.logs.SignLogMessageConstantModifier and TypeConstant FieldValue
public static final String
"Requested algorithm might not be supported by the pdf specification."
public static final String
"Unexpected exception without message was thrown during keystore processing"
public static final String
"Revocation data for certificate: \"{0}\" is not added due to validity assured - short term extension."
public static final String
"Unable to parse certificates coming from authority info access extension. Those won\'t be included into the certificate chain."
public static final String
"Unable to parse signed data revocation info item since it is incorrect or unsupported (e.g. SCVP Request and Response)."
public static final String
"The certificate was valid on the verification date, but has been revoked since {0}."
-
com.itextpdf.signatures.validation.v1.CertificateChainValidatorModifier and TypeConstant FieldValue
static final String
"Certificate check."
static final String
"Certificate {0} is trusted, revocation data checks are not required."
static final String
"Certificate {0} is trusted for {1}, but it is not used in this context. Validation will continue as usual."
static final String
"Certificate {0} is expired."
static final String
"Required extension {0} is missing or incorrect."
static final String
"Required certificate extensions check."
static final String
"Issuer certificate {0} for subject certificate {1} cannot be mathematically verified."
static final String
"Certificate {0} isn\'t trusted and issuer certificate isn\'t provided."
static final String
"Unexpected exception occurred while retrieving certificate issuer from IssuingCertificateRetriever."
static final String
"Unexpected exception occurred while verifying issuer certificate."
static final String
"Certificate {0} is not yet valid."
static final String
"Unexpected exception occurred while validating certificate revocation."
static final String
"Unexpected exception occurred while retrieving trust store from IssuingCertificateRetriever."
static final String
"Certificate validity period check."
static final String
"Unexpected exception occurred while validating certificate validity period."
-
com.itextpdf.signatures.validation.v1.CRLValidatorModifier and TypeConstant FieldValue
static final int
32895
static final String
"The onlyContainsAttributeCerts is asserted. Conforming CRLs issuers MUST set the onlyContainsAttributeCerts boolean to FALSE."
static final String
"Certificate is expired on {0} and could have been removed from the CRL."
static final String
"Certificate isn\'t in the current CRL scope."
static final String
"The certificate was unrevoked."
static final String
"Certificate was revoked by {0} on {1}."
static final String
"CRL response check."
static final String
"CRL response is invalid."
static final String
"Unable to validate CRL response: Unexpected exception occurred validating issuer certificate."
static final String
"The CRL issuer does not share the root of the inspected certificate."
static final String
"Unable to validate CRL response: no issuer certificate found."
static final String
"Unable to validate CRL response: Unexpected exception occurred retrieving issuer certificate."
static final String
"CRL response is not fresh enough: this update: {0}, validation date: {1}, freshness: {2}."
static final String
"Revocation status cannot be determined since not all reason codes are covered by the current CRL."
static final String
"CRLs that cover the same reason codes were already verified."
static final String
"nextUpdate: {0} of CRLResponse is before validation date {1}."
-
com.itextpdf.signatures.validation.v1.DocumentRevisionsValidatorModifier and TypeConstant FieldValue
static final String
"Access permissions level specified for \"{0}\" approval signature is higher than previous one specified. These access permissions will be ignored."
static final String
"AcroForm dictionary was removed from catalog."
static final String
"Field annotations were removed, added or unexpectedly modified."
static final String
"Base version number in developer extension \"{0}\" dictionary was decreased."
static final String
"Base version number in developer extension \"{0}\" dictionary is not parsable."
static final String
"Developer extension \"{0}\" dictionary was removed or unexpectedly modified."
static final String
"{0} must be an indirect reference."
static final String
"DocMDP check."
static final String
"Document doesn\'t contain any signatures."
static final String
"DSS dictionary was removed from catalog."
private static final float
9.999999747378752E-6f
static final String
"Extension level number in developer extension \"{0}\" dictionary was decreased."
static final String
"Extensions dictionary was removed from the catalog."
static final String
"Developer extensions must be a dictionary."
static final String
"FieldMDP check."
static final String
"Form field \"{0}\" or one of its widgets is not a dictionary. It will not be validated."
static final String
"Form field {0} was removed or unexpectedly modified."
static final String
"Linearized PDF documents are not supported by DocumentRevisionsValidator."
static final String
"Kids were added to locked form field \"{0}\"."
static final String
"Kids were removed from locked form field \"{0}\" ."
static final String
"Locked form field \"{0}\" or one of its widgets was modified."
static final String
"Locked form field \"{0}\" was removed from the document."
static final String
"PDF document AcroForm contains changes other than document timestamp (docMDP level >= 1), form fill-in and digital signatures (docMDP level >= 2), adding or editing annotations (docMDP level 3), which are not allowed."
static final String
"PDF document catalog contains changes other than DSS dictionary and DTS addition (docMDP level >= 1), form fill-in and digital signatures (docMDP level >= 2), adding or editing annotations (docMDP level 3)."
static final String
"Object \"{0}\", which is not allowed to be removed, was removed from the document through XREF table."
static final String
"Outlines entry in catalog dictionary was modified. iText currently cannot identify if these modifications are allowed."
static final String
"Page annotations were unexpectedly modified."
static final String
"Page was unexpectedly modified."
static final String
"Pages structure was unexpectedly modified."
static final String
"Permission \"{0}\" dictionary was removed or unexpectedly modified."
static final String
"Permissions dictionary was removed from the catalog."
static final String
"Permissions must be a dictionary."
static final String
"Signature reference dictionary was removed or unexpectedly modified."
static final String
"IOException occurred during document revisions reading."
static final String
"Wasn\'t possible to retrieve document revisions."
static final String
"Unexpected exception while retrieving document revisions."
static final String
"Signature {0} was unexpectedly modified."
static final String
"Not possible to identify document revision corresponding to the first signature in the document."
static final String
"Struct tree content element is unexpectedly modified."
static final String
"Struct tree element is unexpectedly modified."
static final String
"StructTreeRoot which contains not allowed entries was added to the catalog."
static final String
"StructTreeRoot was unexpectedly modified."
static final String
"StructTreeRoot, which is not a dictionary, was modified."
static final String
"StructTreeRoot was removed from the catalog."
static final String
"Document contains more than one certification signature."
static final String
"New PDF document revision contains unexpected entry \"{0}\" in XREF table."
static final String
"New PDF document revision contains unexpected form field \"{0}\"."
static final String
"Access permissions level number specified for \"{0}\" signature is undefined. Default level 2 will be used instead."
static final String
"Signature field lock dictionary contains unrecognized \"Action\" value \"{0}\". \"All\" will be used instead."
-
com.itextpdf.signatures.validation.v1.OCSPValidatorModifier and TypeConstant FieldValue
static final String
"Certificate is expired on {0}. Its revocation status could have been removed from the database, so the OCSP response status could be falsely valid."
static final String
"Certificate status is revoked."
static final String
"Certificate status is unknown."
static final String
"OCSP response is not fresh enough: this update: {0}, validation date: {1}, freshness: {2}."
static final String
"OCSP response is invalid."
static final String
"OCSP: Issuers don\'t match."
static final String
"OCSP response check."
static final String
"OCSP response could not be verified: it does not contain responder in the certificate chain and response is not signed by issuer certificate or any from the trusted store."
static final String
"OCSP is no longer valid: {0} after {1}"
static final String
"OCSP response could not be verified: \" +\n \"Unexpected exception occurred retrieving responder."
static final String
"OCSP response could not be verified: \" +\n \" Unexpected exception occurred while validating responder certificate."
static final String
"OCSP response could not be verified: \" +\n \"responder trust state could not be retrieved."
static final String
"OCSP: Serial numbers don\'t match."
static final String
"OCSP response could not be verified: Unexpected exception occurred checking if issuers match."
static final String
"OCSP response could not be verified: Unexpected exception occurred while retrieving issuer"
-
com.itextpdf.signatures.validation.v1.RevocationDataValidatorModifier and TypeConstant FieldValue
static final String
"CRL response from \"{0}\" CRL response cannot be parsed."
static final String
"OCSP response from \"{0}\" OCSP response cannot be parsed."
static final String
"Unexpected exception occurred in CRL client \"{0}\"."
static final String
"Unexpected exception occurred in CRL validator."
static final String
"Retrieval of the certificate issuer failed."
static final String
"Certificate revocation status cannot be checked: no revocation data available or the status cannot be determined."
static final String
"Unexpected exception occurred in OCSP client \"{0}\"."
static final String
"Unexpected exception occurred in OCSP validator."
static final String
"Revocation data check."
static final String
"Certificate is self-signed. Revocation data check will be skipped."
static final String
"Authorized OCSP Responder certificate has id-pkix-ocsp-nocheck extension so it is trusted by the definition and no revocation checking is performed."
static final String
"Certificate is trusted due to validity assured - short term extension."
-
com.itextpdf.signatures.validation.v1.SignatureValidationPropertiesModifier and TypeConstant FieldValue
public static final boolean
true
-
com.itextpdf.signatures.validation.v1.SignatureValidatorModifier and TypeConstant FieldValue
static final String
"Unexpected exception occurred adding known certificates to certificate retriever."
static final String
"Certificate {0} stored in DSS dictionary cannot be parsed."
static final String
"CRL {0} stored in DSS dictionary cannot be parsed."
static final String
"OCSP response {0} stored in DSS dictionary cannot be parsed."
static final String
"Signature {0} cannot be mathematically verified."
static final String
"Signature timestamp attribute cannot be verified."
static final String
"Unexpected exception occurred during certificate chain validation."
static final String
"Signature {0} doesn\'t cover entire document."
static final String
"Unexpected exception occurred during document revisions retrieval."
static final String
"Unexpected exception occurred during revisions validation."
static final String
"Signature verification check."
static final String
"Unexpected exception occurred retrieving prove of existence from timestamp signature"
static final String
"Timestamp verification check."
static final String
"Unexpected exception occurred during mathematical verification of time stamp signature."
public static final String
"Validating signature {0}"
-
com.itextpdf.signatures.validation.v1.extensions.ExtendedKeyUsageExtension
-
com.itextpdf.styledxmlparser.CommonAttributeConstants
-
com.itextpdf.styledxmlparser.css.CommonCssConstantsModifier and TypeConstant FieldValue
public static final String
"active"
public static final String
"align-content"
public static final String
"align-items"
public static final String
"align-self"
public static final String
"always"
public static final String
"anywhere"
public static final String
"armenian"
public static final String
"attr"
public static final String
"auto"
public static final String
"auto-flow"
public static final String
"avoid"
public static final String
"background"
public static final String
"background-attachment"
public static final String
"background-blend-mode"
public static final String
"background-clip"
public static final String
"background-color"
public static final String
"background-image"
public static final String
"background-origin"
public static final String
"background-position"
public static final String
"background-position-x"
public static final String
"background-position-y"
public static final String
"background-repeat"
public static final String
"background-size"
public static final String
"baseline"
public static final String
"blink"
public static final String
"bold"
public static final String
"bolder"
public static final String
"border"
public static final String
"border-bottom"
public static final String
"border-bottom-color"
public static final String
"border-bottom-left-radius"
public static final String
"border-bottom-right-radius"
public static final String
"border-bottom-style"
public static final String
"border-bottom-width"
public static final String
"border-box"
public static final String
"border-collapse"
public static final String
"border-color"
public static final String
"border-image"
public static final String
"border-left"
public static final String
"border-left-color"
public static final String
"border-left-style"
public static final String
"border-left-width"
public static final String
"border-radius"
public static final String
"border-right"
public static final String
"border-right-color"
public static final String
"border-right-style"
public static final String
"border-right-width"
public static final String
"border-spacing"
public static final String
"border-style"
public static final String
"border-top"
public static final String
"border-top-color"
public static final String
"border-top-left-radius"
public static final String
"border-top-right-radius"
public static final String
"border-top-style"
public static final String
"border-top-width"
public static final String
"border-width"
public static final String
"bottom"
public static final String
"box-shadow"
public static final String
"break-all"
public static final String
"break-word"
public static final String
"caption"
public static final String
"caption-side"
public static final String
"center"
public static final String
"checked"
public static final String
"circle"
public static final String
"cjk-ideographic"
public static final String
"close-quote"
public static final String
"cm"
public static final String
"color"
public static final String
"color-burn"
public static final String
"color-dodge"
public static final String
"column"
public static final String
"column-count"
public static final String
"column-gap"
public static final String
"column-reverse"
public static final String
"column-rule"
public static final String
"column-rule-color"
public static final String
"column-rule-style"
public static final String
"column-rule-width"
public static final String
"column-width"
public static final String
"columns"
public static final String
"contain"
public static final String
"content"
public static final String
"content-box"
public static final String
"cover"
public static final String
"currentcolor"
public static final String
"darken"
public static final String
"dashed"
public static final String
"decimal"
public static final String
"decimal-leading-zero"
public static final String
"deg"
public static final String
"dense"
public static final String
"difference"
public static final String
"direction"
public static final String
"disabled"
public static final String
"disc"
public static final String
"display"
public static final String
"dotted"
public static final String
"double"
public static final String
"dpcm"
public static final String
"dpi"
public static final String
"dppx"
public static final String
"each-line"
public static final String
"em"
public static final String
"empty"
public static final String
"empty-cells"
public static final String
"enabled"
public static final String
"end"
public static final String
"ex"
public static final String
"exclusion"
public static final String
"first"
public static final String
"first-child"
public static final String
"first-of-type"
public static final String
"fit-content"
public static final String
"fixed"
public static final String
"flex"
public static final String
"flex-basis"
public static final String
"flex-direction"
public static final String
"flex-end"
public static final String
"flex-flow"
public static final String
"flex-grow"
public static final String
"flex-shrink"
public static final String
"flex-start"
public static final String
"flex-wrap"
public static final String
"float"
public static final String
"focus"
public static final String
"font"
public static final String
"font-family"
public static final String
"font-feature-settings"
public static final String
"font-kerning"
public static final String
"font-language-override"
public static final String
"font-size"
public static final String
"font-size-adjust"
public static final String
"font-stretch"
public static final String
"font-style"
public static final String
"font-synthesis"
public static final String
"font-variant"
public static final String
"font-variant-alternates"
public static final String
"font-variant-caps"
public static final String
"font-variant-east-asian"
public static final String
"font-variant-ligatures"
public static final String
"font-variant-numeric"
public static final String
"font-variant-position"
public static final String
"font-weight"
public static final String
"fr"
public static final String
"gap"
public static final String
"georgian"
public static final String
"grad"
public static final String
"grid"
public static final String
"grid-auto-columns"
public static final String
"grid-auto-flow"
public static final String
"grid-auto-rows"
public static final String
"grid-column"
public static final String
"grid-column-end"
public static final String
"grid-column-gap"
public static final String
"grid-column-start"
public static final String
"grid-gap"
public static final String
"grid-row"
public static final String
"grid-row-end"
public static final String
"grid-row-gap"
public static final String
"grid-row-start"
public static final String
"grid-template"
public static final String
"grid-template-areas"
public static final String
"grid-template-columns"
public static final String
"grid-template-rows"
public static final String
"groove"
public static final String
"hanging"
public static final String
"hanging-punctuation"
public static final String
"hard-light"
public static final String
"hebrew"
public static final String
"height"
public static final String
"hidden"
public static final String
"hiragana"
public static final String
"hiragana-iroha"
public static final String
"hover"
public static final String
"hue"
public static final String
"hyphens"
public static final String
"icon"
public static final String
"in"
public static final String
"in-range"
public static final String
"inherit"
public static final String
"initial"
public static final String
"inline-block"
public static final String
"inset"
public static final String
"inside"
public static final String
"invalid"
public static final String
"italic"
public static final String
"justify-content"
public static final String
"justify-items"
public static final String
"keep-all"
public static final String
"lang"
public static final String
"large"
public static final String
"larger"
public static final String
"last"
public static final String
"last-child"
public static final String
"last-of-type"
public static final String
"left"
public static final String
"legacy"
public static final String
"letter-spacing"
public static final String
"lighten"
public static final String
"lighter"
public static final String
"line-height"
public static final String
"line-through"
public static final String
"link"
public static final String
"list-style"
public static final String
"list-style-image"
public static final String
"list-style-position"
public static final String
"list-style-type"
public static final String
"local"
public static final String
"lower-alpha"
public static final String
"lower-greek"
public static final String
"lower-latin"
public static final String
"lower-roman"
public static final String
"luminosity"
public static final String
"manual"
public static final String
"margin"
public static final String
"margin-bottom"
public static final String
"margin-left"
public static final String
"margin-right"
public static final String
"margin-top"
public static final String
"matrix"
public static final String
"max-content"
public static final String
"medium"
public static final String
"menu"
public static final String
"message-box"
public static final String
"min-content"
public static final String
"min-height"
public static final String
"mm"
public static final String
"multiply"
public static final String
"no-close-quote"
public static final String
"no-open-quote"
public static final String
"no-repeat"
public static final String
"none"
public static final String
"normal"
public static final String
"not"
public static final String
"nowrap"
public static final String
"nth-child"
public static final String
"nth-last-child"
public static final String
"nth-last-of-type"
public static final String
"nth-of-type"
public static final String
"oblique"
public static final String
"only-child"
public static final String
"only-of-type"
public static final String
"opacity"
public static final String
"open-quote"
public static final String
"optional"
public static final String
"order"
public static final String
"orphans"
public static final String
"out-of-range"
public static final String
"outline"
public static final String
"outline-color"
public static final String
"outline-style"
public static final String
"outline-width"
public static final String
"outset"
public static final String
"outside"
public static final String
"overflow"
public static final String
"overflow-wrap"
public static final String
"overlay"
public static final String
"overline"
public static final String
"padding"
public static final String
"padding-bottom"
public static final String
"padding-box"
public static final String
"padding-left"
public static final String
"padding-right"
public static final String
"padding-top"
public static final String
"page-break-after"
public static final String
"page-break-before"
public static final String
"page-break-inside"
public static final String
"pc"
public static final String
"%"
public static final String
"place-items"
public static final String
"position"
public static final String
"pt"
public static final String
"px"
public static final String
"q"
public static final String
"quotes"
public static final String
"rad"
public static final String
"read-only"
public static final String
"read-write"
public static final String
"rem"
public static final String
"repeat"
public static final String
"repeat-x"
public static final String
"repeat-y"
public static final String
"required"
public static final String
"ridge"
public static final String
"right"
public static final String
"root"
public static final String
"rotate"
public static final String
"round"
public static final String
"row"
public static final String
"row-gap"
public static final String
"row-reverse"
public static final String
"safe"
public static final String
"saturation"
public static final String
"scale"
public static final String
"scalex"
public static final String
"scaley"
public static final String
"screen"
public static final String
"scroll"
public static final String
"self-end"
public static final String
"self-start"
public static final String
"skew"
public static final String
"skewx"
public static final String
"skewy"
public static final String
"small"
public static final String
"small-caps"
public static final String
"small-caption"
public static final String
"smaller"
public static final String
"soft-light"
public static final String
"solid"
public static final String
"space"
public static final String
"space-around"
public static final String
"space-between"
public static final String
"space-evenly"
public static final String
"square"
public static final String
"start"
public static final String
"static"
public static final String
"status-bar"
public static final String
"stretch"
public static final String
"string"
public static final String
"tab-size"
public static final String
"target"
public static final String
"text-align"
public static final String
"text-align-last"
public static final String
"text-combine-upright"
public static final String
"text-decoration"
public static final String
"text-decoration-color"
public static final String
"text-decoration-line"
public static final String
"text-decoration-style"
public static final String
"text-indent"
public static final String
"text-justify"
public static final String
"text-orientation"
public static final String
"text-shadow"
public static final String
"text-transform"
public static final String
"text-underline-position"
public static final String
"thick"
public static final String
"thin"
public static final String
"top"
public static final String
"transform"
public static final String
"translate"
public static final String
"translatex"
public static final String
"translatey"
public static final String
"transparent"
public static final String
"undefined"
public static final String
"underline"
public static final String
"unicode-bidi"
public static final String
"unsafe"
public static final String
"unset"
public static final String
"upper-alpha"
public static final String
"upper-latin"
public static final String
"upper-roman"
public static final String
"url"
public static final String
"valid"
public static final String
"visibility"
public static final String
"visible"
public static final String
"visited"
public static final String
"wavy"
public static final String
"white-space"
public static final String
"widows"
public static final String
"width"
public static final String
"word-break"
public static final String
"word-spacing"
public static final String
"word-wrap"
public static final String
"wrap"
public static final String
"wrap-reverse"
public static final String
"writing-mode"
public static final String
"x-large"
public static final String
"x-small"
public static final String
"xx-large"
public static final String
"xx-small"
-
com.itextpdf.styledxmlparser.css.CssRuleNameModifier and TypeConstant FieldValue
public static final String
"bottom-center"
public static final String
"bottom-left"
public static final String
"bottom-left-corner"
public static final String
"bottom-right"
public static final String
"bottom-right-corner"
public static final String
"font-face"
public static final String
"left-bottom"
public static final String
"left-middle"
public static final String
"left-top"
public static final String
"media"
public static final String
"page"
public static final String
"right-bottom"
public static final String
"right-middle"
public static final String
"right-top"
public static final String
"top-center"
public static final String
"top-left"
public static final String
"top-left-corner"
public static final String
"top-right"
public static final String
"top-right-corner"
-
com.itextpdf.styledxmlparser.css.font.CssFontFace.CssFontFaceSrcModifier and TypeConstant FieldValue
public static final int
9
public static final int
1
public static final int
4
-
com.itextpdf.styledxmlparser.css.media.MediaExpression
-
com.itextpdf.styledxmlparser.css.media.MediaFeatureModifier and TypeConstant FieldValue
public static final String
"aspect-ratio"
public static final String
"color"
public static final String
"color-index"
public static final String
"grid"
public static final String
"height"
public static final String
"monochrome"
public static final String
"orientation"
public static final String
"resolution"
public static final String
"scan"
public static final String
"width"
-
com.itextpdf.styledxmlparser.css.media.MediaRuleConstants
-
com.itextpdf.styledxmlparser.css.page.PageContextConstants
-
com.itextpdf.styledxmlparser.css.page.PageMarginBoxContextNode
-
com.itextpdf.styledxmlparser.css.parse.CssPageSelectorParserModifier and TypeConstant FieldValue
private static final String
"(^-?[_a-zA-Z][\\w-]*)|(:(?i)(left|right|first|blank))"
-
com.itextpdf.styledxmlparser.css.parse.CssSelectorParserModifier and TypeConstant FieldValue
private static final String
"(\\*)|([_a-zA-Z][\\w-]*)|(\\.[_a-zA-Z][\\w-]*)|(#[_a-z][\\w-]*)|(\\[[_a-zA-Z][\\w-]*(([~^$*|])?=((\"[^\"]+\")|([^\"]+)|(\'[^\']+\')|(\"\")|(\'\')))?\\])|(::?[a-zA-Z-]*)|( )|(\\+)|(>)|(~)"
-
com.itextpdf.styledxmlparser.css.pseudo.CssPseudoElementUtil
-
com.itextpdf.styledxmlparser.css.resolve.CssQuotes
-
com.itextpdf.styledxmlparser.css.resolve.shorthand.impl.AbstractBorderShorthandResolver
-
com.itextpdf.styledxmlparser.css.resolve.shorthand.impl.AbstractBoxShorthandResolver
-
com.itextpdf.styledxmlparser.css.resolve.shorthand.impl.AbstractCornersShorthandResolver
-
com.itextpdf.styledxmlparser.css.resolve.shorthand.impl.BackgroundPositionShorthandResolver
-
com.itextpdf.styledxmlparser.css.selector.item.com.itextpdf.styledxmlparser.css.selector.item.CssSpecificityConstantsModifier and TypeConstant FieldValue
public static final int
1024
public static final int
1
public static final int
1048576
-
com.itextpdf.styledxmlparser.css.util.CssGradientUtil
-
com.itextpdf.styledxmlparser.css.util.CssUtilsModifier and TypeConstant FieldValue
private static final float
9.999999974752427E-7f
private static final int
2
-
com.itextpdf.styledxmlparser.css.validate.impl.datatype.CssBackgroundValidator
-
com.itextpdf.styledxmlparser.exceptions.StyledXMLParserExceptionModifier and TypeConstant FieldValue
public static final String
"Font Provider contains zero fonts. At least one font shall be present"
public static final String
"Invalid color stop value: {0}"
public static final String
"Invalid gradient function arguments list: {0}"
public static final String
"Invalid direction string: {0}"
public static final String
"The passed value (@{0}) is not a number"
public static final String
"Unsupported encoding exception."
-
com.itextpdf.styledxmlparser.exceptions.StyledXmlParserExceptionMessage
-
com.itextpdf.styledxmlparser.jsoup.helper.DataUtilModifier and TypeConstant FieldValue
static final int
32
static final int
32768
private static final int
5120
-
com.itextpdf.styledxmlparser.jsoup.internal.ConstrainableInputStream
-
com.itextpdf.styledxmlparser.jsoup.internal.StringUtilModifier and TypeConstant FieldValue
private static final int
8192
private static final int
8
private static final int
30
-
com.itextpdf.styledxmlparser.jsoup.nodes.Attributes
-
com.itextpdf.styledxmlparser.jsoup.nodes.DocumentType
-
com.itextpdf.styledxmlparser.jsoup.nodes.EntitiesModifier and TypeConstant FieldValue
static final int
36
private static final int
-1
private static final String
""
-
com.itextpdf.styledxmlparser.jsoup.nodes.Node
-
com.itextpdf.styledxmlparser.jsoup.parser.CharacterReaderModifier and TypeConstant FieldValue
static final char
'\uffff'
static final int
32768
private static final int
12
private static final int
1024
static final int
24576
private static final int
512
-
com.itextpdf.styledxmlparser.jsoup.parser.HtmlTreeBuilderModifier and TypeConstant FieldValue
private static final int
256
public static final int
100
-
com.itextpdf.styledxmlparser.jsoup.parser.ParseErrorList
-
com.itextpdf.styledxmlparser.jsoup.parser.com.itextpdf.styledxmlparser.jsoup.parser.TokeniserModifier and TypeConstant FieldValue
static final char
'\ufffd'
static final int
128
-
com.itextpdf.styledxmlparser.jsoup.parser.com.itextpdf.styledxmlparser.jsoup.parser.TokeniserStateModifier and TypeConstant FieldValue
private static final char
'\uffff'
static final char
'\u0000'
private static final char
'\ufffd'
-
com.itextpdf.styledxmlparser.jsoup.parser.TokenQueue
-
com.itextpdf.styledxmlparser.logs.StyledXmlParserLogMessageConstantModifier and TypeConstant FieldValue
public static final String
"Default value of the css property \"{0}\" is unknown."
public static final String
"Error adding child node."
public static final String
"Could not map node type: {0}"
public static final String
"Error while parsing css selector: {0}"
public static final String
"Element parent styles are not resolved. Styles for current element might be incorrect."
public static final String
"Incorrect character sequence."
public static final String
"Resolution value unit should be either dpi, dppx or dpcm!"
public static final String
"Invalid css property declaration: {0}"
public static final String
"Only the last background can include a background color."
public static final String
"The quote is not closed in css expression: {0}"
public static final String
"Quote property \"{0}\" is invalid. It should contain even number of <string> values."
public static final String
"Resource with given URL ({0}) was filtered out."
public static final String
"The rule @{0} is unsupported. All selectors in this rule will be ignored."
public static final String
"{0} shorthand property cannot be empty."
public static final String
"Unable to process external css file"
public static final String
"Unable to resolve image path with given base URI ({0}) and image source path ({1})"
public static final String
"Unable to retrieve font:\n {0}"
public static final String
"Unable to retrieve image with given base URI ({0}) and image source path ({1})"
public static final String
"Unable to retrieve image with data URI {0}"
public static final String
"Unable to retrieve resource with given URL ({0}) and resource size byte limit ({1})."
public static final String
"Unable to retrieve stream with given base URI ({0}) and source path ({1})"
public static final String
"Unknown absolute metric length parsed \"{0}\"."
public static final String
"Unknown metric angle parsed: \"{0}\"."
public static final String
"Unknown {0} property: \"{1}\"."
public static final String
"Unsupported pseudo css selector: {0}"
public static final String
"url function is empty in expression:{0}"
public static final String
"url function is not properly closed in expression:{0}"
public static final String
"Was not able to define one of the background CSS shorthand properties: {0}"
-
com.itextpdf.styledxmlparser.resolver.font.BasicFontProvider
-
com.itextpdf.styledxmlparser.resolver.resource.ResourceResolver
-
com.itextpdf.styledxmlparser.resolver.resource.com.itextpdf.styledxmlparser.resolver.resource.UriEncodeUtil
-
com.itextpdf.svg.SvgConstants.AttributesModifier and TypeConstant FieldValue
public static final String
"bold"
public static final String
"clip-path"
public static final String
"clip-rule"
public static final String
"cx"
public static final String
"cy"
public static final String
"d"
public static final String
"dx"
public static final String
"dy"
public static final String
"fill"
public static final String
"fill-opacity"
public static final String
"fill-rule"
public static final String
"font-family"
public static final String
"font-size"
public static final String
"font-style"
public static final String
"font-weight"
public static final String
"gradientTransform"
public static final String
"gradientUnits"
public static final String
"height"
public static final String
"href"
public static final String
"id"
public static final String
"italic"
public static final String
"marker-end"
public static final String
"markerHeight"
public static final String
"marker-mid"
public static final String
"marker-start"
public static final String
"markerUnits"
public static final String
"markerWidth"
public static final String
"offset"
public static final String
"opacity"
public static final String
"orient"
public static final String
"B"
public static final String
"R"
public static final String
"Z"
public static final String
"C"
public static final String
"S"
public static final String
"A"
public static final String
"L"
public static final String
"H"
public static final String
"V"
public static final String
"M"
public static final String
"Q"
public static final String
"b"
public static final String
"r"
public static final String
"c"
public static final String
"s"
public static final String
"a"
public static final String
"l"
public static final String
"h"
public static final String
"v"
public static final String
"m"
public static final String
"q"
public static final String
"t"
public static final String
"T"
public static final String
"patternContentUnits"
public static final String
"patternTransform"
public static final String
"patternUnits"
public static final String
"points"
public static final String
"preserveAspectRatio"
public static final String
"r"
public static final String
"refX"
public static final String
"refY"
public static final String
"rx"
public static final String
"ry"
public static final String
"spreadMethod"
public static final String
"stroke"
public static final String
"stroke-dasharray"
public static final String
"stroke-dashoffset"
public static final String
"stroke-linecap"
public static final String
"stroke-miterlimit"
public static final String
"stroke-opacity"
public static final String
"stroke-width"
public static final String
"style"
public static final String
"text-anchor"
public static final String
"text_content"
public static final String
"transform"
public static final String
"version"
public static final String
"viewBox"
public static final String
"width"
public static final String
"x"
public static final String
"x1"
public static final String
"x2"
public static final String
"xlink:href"
public static final String
"xmlns"
public static final String
"y"
public static final String
"y1"
public static final String
"y2"
-
com.itextpdf.svg.SvgConstants.TagsModifier and TypeConstant FieldValue
public static final String
"a"
public static final String
"altGlyph"
public static final String
"altGlyphDef"
public static final String
"altGlyphItem"
public static final String
"animate"
public static final String
"animateColor"
public static final String
"animateMotion"
public static final String
"animateTransform"
public static final String
"circle"
public static final String
"clipPath"
public static final String
"color-profile"
public static final String
"cursor"
public static final String
"defs"
public static final String
"desc"
public static final String
"ellipse"
public static final String
"feBlend"
public static final String
"feColorMatrix"
public static final String
"feComponentTransfer"
public static final String
"feComposite"
public static final String
"feConvolveMatrix"
public static final String
"feDiffuseLighting"
public static final String
"feDisplacementMap"
public static final String
"feDistantLight"
public static final String
"feFlood"
public static final String
"feFuncA"
public static final String
"feFuncB"
public static final String
"feFuncG"
public static final String
"feFuncR"
public static final String
"feGaussianBlur"
public static final String
"feImage"
public static final String
"feMerge"
public static final String
"feMergeNode"
public static final String
"feMorphology"
public static final String
"feOffset"
public static final String
"fePointLight"
public static final String
"feSpecularLighting"
public static final String
"feSpotLight"
public static final String
"feTile"
public static final String
"feTurbulence"
public static final String
"filter"
public static final String
"font"
public static final String
"font-face"
public static final String
"font-face-format"
public static final String
"font-face-name"
public static final String
"font-face-src"
public static final String
"font-face-uri"
public static final String
"foreignObject"
public static final String
"g"
public static final String
"glyph"
public static final String
"glyphRef"
public static final String
"hkern"
public static final String
"image"
public static final String
"line"
public static final String
"linearGradient"
public static final String
"link"
public static final String
"marker"
public static final String
"mask"
public static final String
"metadata"
public static final String
"missing-glyph"
public static final String
"mpath"
public static final String
"path"
public static final String
"pattern"
public static final String
"polygon"
public static final String
"polyline"
public static final String
"radialGradient"
public static final String
"rect"
public static final String
"script"
public static final String
"set"
public static final String
"stop"
public static final String
"stop-color"
public static final String
"stop-opacity"
public static final String
"style"
public static final String
"svg"
public static final String
"switch"
public static final String
"symbol"
public static final String
"text"
public static final String
":text-leaf"
public static final String
"textPath"
public static final String
"title"
public static final String
"tspan"
public static final String
"use"
public static final String
"view"
public static final String
"vkern"
-
com.itextpdf.svg.SvgConstants.ValuesModifier and TypeConstant FieldValue
public static final String
"auto"
public static final String
"auto-start-reverse"
public static final String
"butt"
public static final String
"xmidymid"
public static final String
"defer"
public static final String
"evenodd"
public static final String
"nonzero"
public static final String
"meet"
public static final String
"none"
public static final String
"objectBoundingBox"
public static final String
"slice"
public static final String
"pad"
public static final String
"reflect"
public static final String
"repeat"
public static final String
"strokeWidth"
public static final String
"end"
public static final String
"middle"
public static final String
"start"
public static final String
"userSpaceOnUse"
public static final String
"1.1"
public static final String
"xmaxymax"
public static final String
"xmaxymid"
public static final String
"xmaxymin"
public static final String
"xmidymax"
public static final String
"xmidymid"
public static final String
"xmidymin"
public static final String
"xminymax"
public static final String
"xminymid"
public static final String
"xminymin"
-
com.itextpdf.svg.css.impl.SvgStyleResolver
-
com.itextpdf.svg.exceptions.SvgExceptionMessageConstantModifier and TypeConstant FieldValue
public static final String
"(rx ry rot largearc sweep x y)+ parameters are expected for elliptical arcs. Got: {0}"
public static final String
"Array of current coordinates must have length that is divisible by the length of the array with current coordinates"
public static final String
"Could not determine the middle point of the ellipse traced by this elliptical arc"
public static final String
"The current viewport is null. The viewBox applying could not be processed."
public static final String
"(x1 y1 x2 y2 x y)+ parameters are expected for curves. Got: {0}"
public static final String
"The renderer cannot be drawn."
public static final String
"Failed to parse InputStream."
public static final String
"The font wasn\'t found."
public static final String
"Input root value is null"
public static final String
"The close path operator (Z) may not be used before a move to operation (M)"
public static final String
"Invalid operators found in path data attribute: {0}"
public static final String
"The smooth curve operations (S, s, T, t) may not be used as a first operator in path."
public static final String
"Transformation declaration is not formed correctly."
public static final String
"(x y)+ parameters are expected for lineTo operator. Got: {0}"
public static final String
"The meetOrSlice argument is incorrect. It must be `meet`, `slice` or null."
public static final String
"(x y)+ parameters are expected for moveTo operator. Got: {0}"
public static final String
"The name of the named object can\'t be null or empty."
public static final String
"A named object can\'t be null."
public static final String
"No root found"
public static final String
"Parameters cannot be null."
public static final String
"Points attribute {0} on polyline tag does not contain a valid set of points"
public static final String
"(x1 y1 x y)+ parameters are expected for quadratic curves. Got: {0}"
public static final String
"The root svg tag needs to have a bounding box defined."
public static final String
"Tag parameter must not be null"
public static final String
"The transformation value is empty."
public static final String
"Transformation doesn\'t contain the right number of values."
public static final String
"The transformation value is null."
public static final String
"Unsupported type of transformation."
public static final String
"The viewBox is incorrect. The viewBox applying could not be processed."
-
com.itextpdf.svg.logs.SvgLogMessageConstantModifier and TypeConstant FieldValue
public static final String
"Custom AbstractCssContext implementations are not supported yet"
public static final String
"Error loading the default CSS. Initializing an empty style sheet."
public static final String
"Could not recognize gradient units value {0}"
public static final String
"Could not recognize gradient spread method value {0}"
public static final String
"markerHeight has negative value. Marker will not be rendered."
public static final String
"markerHeight has zero value. Marker will not be rendered."
public static final String
"markerWidth has negative value. Marker will not be rendered."
public static final String
"markerWidth has zero value. Marker will not be rendered."
public static final String
"Top Svg tag has no defined height attribute and viewbox height is not present, so browser default of 150px is used"
public static final String
"Top Svg tag has no defined width attribute and viewbox width is not present, so browser default of 300px is used"
public static final String
"Non-invertible transformation matrix was used in a clipping path context. Clipped elements may show undefined behavior."
public static final String
"Could not recognize patternContentUnits value {0}"
public static final String
"Could not recognize patternUnits value {0}"
public static final String
"Pattern width or height is negative value. This pattern will not be rendered."
public static final String
"Pattern width or height is zero. This pattern will not be rendered."
public static final String
"Unable to get inverse transformation matrix and thus calculate a viewport for the element because some of the transformation matrices, which are written to document, have a determinant of zero value. A bbox of zero values will be used as a viewport for this element."
public static final String
"Unable to retrieve font:\n {0}"
public static final String
"Could not find implementation for tag {0}"
public static final String
"The viewBox value must be 4 numbers. This viewBox=\"{0}\" will not be processed."
public static final String
"The viewBox width and height cannot be negative. This viewBox=\"{0}\" will not be processed."
public static final String
"The viewBox width or height is zero. The element with this viewBox will not be rendered."
-
com.itextpdf.svg.renderers.impl.AbstractBranchSvgNodeRenderer
-
com.itextpdf.svg.renderers.impl.LinearGradientSvgNodeRenderer
-
com.itextpdf.svg.renderers.impl.MarkerSvgNodeRendererModifier and TypeConstant FieldValue
private static final float
2.25f
private static final float
2.25f
private static final float
0.0f
private static final float
0.0f
-
com.itextpdf.svg.renderers.impl.PathSvgNodeRenderer
-
com.itextpdf.svg.renderers.impl.PatternSvgNodeRenderer
-
com.itextpdf.svg.renderers.impl.TextSvgTSpanBranchRenderer
-
com.itextpdf.svg.renderers.path.impl.ClosePath
-
com.itextpdf.svg.renderers.path.impl.CurveTo
-
com.itextpdf.svg.renderers.path.impl.EllipticalCurveToModifier and TypeConstant FieldValue
static final int
7
private static final double
1.0E-5
-
com.itextpdf.svg.renderers.path.impl.HorizontalLineTo
-
com.itextpdf.svg.renderers.path.impl.LineTo
-
com.itextpdf.svg.renderers.path.impl.MoveTo
-
com.itextpdf.svg.renderers.path.impl.QuadraticCurveTo
-
com.itextpdf.svg.renderers.path.impl.QuadraticSmoothCurveTo
-
com.itextpdf.svg.renderers.path.impl.SmoothSCurveTo
-
com.itextpdf.svg.renderers.path.impl.VerticalLineTo